ELF4 4 (444ԀԀ: : : dqx ;;/lib/ld-linux.so.1t(lxWi$.Gg6v#?{TY/>cR V0]=w&:Uro7M4CE yBd-zD;AFkem@+8p_)<JHP^hQOn*~"|[915b}!LK INZ Ss u`a%',q X3f\j2Ԛ"!$"*4H1T ="E;N<Xg_< eě"mԛl <T""<x<T4"T#t$"VĜ"ԜC"D"tW"  t"<T" E)0"6tV="Bԟ&JR"Yd$"`t4h"n"tĠ|"o4$"T"L  4$"D4,=t""(9WĢ)Ԣ"|K$cD"T"f&",ģ"2"AĚ"H]P"V"\D"bdktf"p^"x$yD"d"C 4D"X$"4^"T"dW<"I6ĝ<#ԝ")$2"8"="E$"K4^"RDE^T4jd"q ygĞ^"Ԟ9%o"$=$Y"40D4T"d"(="Tğ8$V"4#D"*T"/"<FԠL;"UC_$"gDStd"|t8$ġ,ԡ"$$@$"T^"do"C">$>4d"!t"'-"40=Dԣ$K^"W<^ e<l<x(Olibncurses.so.3.0strcpygetgidvsprintfprintwcfgetospeedgeteuid_DYNAMIC__ctype_bgetenverrnogetegid__strtol_internal_IO_stdout_getpidfgetsmemcpy_IO_stderr_endwincreat__overflowtcflushgetuidfeofmallocisattyselect_xstatfflush__environ_initwrite_IO_stdin_killwrefreshstrcatchdirferrorreadstrncmpstrncpyunlinksscanfstrncatfreadfopeninitscrfclosetgetenttcgetattrtimewmovestrcmp_finisprintfatexitstdscrfwriteaccess_GLOBAL_OFFSET_TABLE__fxstatwclearlinkexitfilenowclrtoeolopenfputstcsetattrmkdirclosefreelibc.so.5chrootasctimeioctlpopenutimegetloginrecvconnectpcloseexeclreadlinkdup2tcsendbreaksystemcfgetispeedsiglongjmpsleepgethostbyaddrrmdirsocketreaddir_lxstat__ctype_toupperftruncateputenvbzero__sigjmp_savechmod__setjmpalarmpipegetpgrpunameaccept__libc_initcfsetispeedrenameenvironctimebindinet_addrvprintfinitgroupssetsockopt__fpu_controlfseekctermidcfsetospeedwaitumasktimezonerandsetgidsignalopenloggetusershellbcopylistencryptfdopenforkgettimeofdaylocaltimesrandclearerrinet_ntoagetppidendusershellopendir__uflowsyslogttynamegetpwuiddupgetcwdgethostbynamegetpwnamgetservbynamegethostnamegetpeernamegetsockoptrewindtcgetpgrpsetbuf__setfpucw_exitclosedirfcntltzsetsetuid__ctype_tolowertcflowgetsockname_errno_etext_edata__bss_start_end< < x<<^< $=t(=z<0=49H89<9I@9JD9H9KL9P9T9LX9\9M`9Nd9Oh9l9Pp9 t9 x9 |99999Q99R99S999T9U9999V9W9X9Y9Z9[99\9]999_9`9a9b9c9d:e:f:g :h:i:j:k:l :$:!(:",:n0:#4:o8:p<:q@:$D:rH:sL:uP:vT:wX:x\:y`:%d:{h:|l:}p:&t:~x:'|::(:)::::::*:+:,::-::.:::/:0:::1::2:::3::4::::;;; ;;6;7;; ;9$;:(;<,;0;4;=8;><;?@;D;@H;L;AP;T;BX;C\;`;d;h;l;Dp;Et;Fx;|;G;5,9%09%49h%89h%<9h%@9h%D9h %H9h(%L9h0%P9h8p%T9h@`%X9hHP%\9hP@%`9hX0%d9h` %h9hh%l9hp%p9hx%t9h%x9h%|9h%9h%9h%9h%9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%9h%9h%9h%9h%9h%9h %9h(%9h0%9h8p%9h@`%9hHP%9hP@%9hX0%9h` %9hh%9hp%9hx%9h%9h%9h%:h%:h%:h% :h%:hp%:h`%:hP%:h@% :h0%$:h %(:h%,:h%0:h%4:h%8:h%<:h%@:h%D:h %H:h(%L:h0%P:h8p%T:h@`%X:hHP%\:hP@%`:hX0%d:h` %h:hh%l:hp%p:hx%t:h%x:h%|:h%:h%:h%:h%:h%:hp%:h`%:hP%:h@%:h0%:h %:h%:h%:h%:h%:h%:h%:h%:h %:h(%:h0%:h8p%:h@`%:hHP%:hP@%:hX0%:h` %:hh%:hp%:hx%:h%:h%:h%;h%;h%;h% ;h%;hp%;h`%;hP%;h@% ;h0%$;h %(;h%,;h%0;h%4;h%8;h%<;h%@;h%D;h %H;h(%L;h0%P;h8p%T;h@`%X;hHP%\;hP@%`;hX0%d;h` %h;hh%l;hp%p;hx%t;h%x;h%|;h%;hYЃ1UUUPSQ̀D$$=Ph R!P[6̀vS$9=$9t Ѓ;u[Í6ÐUWVS}u u1}tM9uE}tM9uE} tM 9uE }$tM$9uE$t?u1H(|~ DHH(| ~ D HH(|~KDPh hb j=t$Ph hr jHH(|~ D0HH(|~ DLHH(|~ D\HH(|~ DHH(| ~ D HH(|$~ D$SHHPPjVHHTPNWHHXP2uHH\P uHH`Pu HHdPu$HHhPe[^_ÍvUS1ۍ6C~1ۍv4Pl<t C~14P@<t C~֋]ÐUS= u h n=,tjօU=,tjÍvUS(;5h h j15t8h h j =t!=t8D|EP@h=t5uh 5uhD ]v =8th8h_ Bvhd 5v=j5hg j5f1ۃ=f9~hw ɗ謚Sh h j@d@Ph h j =@t0PxQ=u[*fAjjj =tQ=u hš uC =5h h j=u,=@t hա qhdjjV  @d= t2PL TA5<h h ji =<~jJJtP܍65<h h j) ]Uh jhM jjj Í6U=tT5hb `~4jjP =L~jItO܍vC\vjItOU`jh hn j_ ÐUjhxh jF hxh _hxf=<~jItDO܍6tUh ihM yijj\ Í6US]LHH<Sh h j  tAt.\%1ҍ6fUB~fUB~f`fEfEff=ffff~\ffUB~vfUB~`fEfE=f tffEfEfff=t =Lffff=Lfffffffffffffffff]Í6UWS=0щKщOD;~h 5=|55h 5\ 9tF0҉ψщOD=,h 5X55G\=0щO~{D;rh 555\=0щO~1D;(h 555\0=Ѝx~-D;$h 5x55g|4 j5h jhe[_ÐUS]E (p< UR0/uhjjh 5 u $jjh 5 u $jjhǢ 5 u $5$5h̢ jjXuKR}h֢ x v 5$5h jJ~&=~= ~, 0Sh h h h jh h j h h h h jh h j h h h h jh h j| h h h h jh h jR h# h# h& h/ jh# h# j( jjjjh5 h? hI j hT hjh5[J} hw w\Phh8Vjh8h j=5thw1=Du|5=t[jjhh8}Ah `ha   =hlhl諊} h 5L.jh hۣ j=u =t8TPdjjh </fG fjh h jj5hh(} h t8jh h( j|55ٝSh h- jho螧 jh hG jF hhh誈5thxh` j=xt~hhhn x@dSh hn j3P)%Ph hx j=(t jv=t5=tP[hthDh辇 =(u=,u =t=u5Xj==(u =,t"=l8tH}5XjM=4tV=u"=Ptau5Xj=4t"=t/H}5Xj=uOjh h jEh\hh謆u͋]Uh0u5XP5Xh h j=Ptjh h j1Í6ÐU WVSuEE}} 0ҋ}щHE} ҍJ}}U}+]uV9]uI} }1+E9n+]uuWGut F9~L6ETAC;v+u}~+u~!vuuE PuxtKy1e[^_UEU 8t 68t@8u1Í6UWVSuU 9u>t6Xy0} ЍX| Pǃtu Wv1>t 6 t&|CPt WPWe[^_ÍvUE t Pu=ÍvUWVSM} ]1t\tX~T9tP)y9}S_t319} : B9|t19}v 2B9|tQCe[^_ÍvUWVSu ]}uE u }?u1>{>unKtf=<}=0=}}G}Fu1t@뼄tŃ}u&}DGt} ‹}DGt}8rwKu1e[^_Í6UWVSu1u } uE <]0=]6F] C] t4t0Ћ]DSt]ы]DSt] 8uG뿍ve[^_Í6U4WVSDžju h jjuh j }u7M 9.u/}?.t'=u?{t?[tjQh jmM} u"1*y}u.<Dpt0=<Dpt0=tDž8u(\uKuBDžEM}u<Dpt0=8E E0t ?["116Ƅ(@=~E}Dž6Mt1}u<Dxt0=ƒ\t[-tt]tcmp09Mv}GMI]uƅu8r0Ƅ(8sDž Ƅ(E%À(v{1}G}9t.?{u@9}uH~?uӅSDžDž9t<0GH,6M L9M G}Dž+M@Pnuy9Dž t%Dž>*Džv>\uuDžv>t >, Dž?@PÃtXS@PSRuuu S SZ~1uHPu S%@uNDžF6m*1ҋ}?*u EM9*t}1]?t$6u;?t;*t<v ;{tCF;uޅ~nFPUVbujju Qà (~iDE u6;} ?t$vuuu S  E M 9uߋ} ?%v8u EE M1[^_ÍvUWVS} =}}E}&E EEEE EE +E9E}׍vUUM4uu }~,>t'0ӉHU9} uu]|}vMhSV %PVh j~{nSjSh jQ5hSV,$%PVh j5h h) j =uS=u0jh h; j5v5h hT j= uC ÃSuhl jf5?5L jjhh j%hkÃ~1Sh ISh hJjhh jB=t8hÃt%h5hĩ SS脕SF;6} ?thM55Mh hʩ jHhM5 5Mh h jhM5b5Mh h j(jh h' jjj5fttjh h7 jjj5 v=t1SvhMj5Sh hC j}5<h h[ j؋]ÍvUWVS}WƃVh hg j<蚽Sh hy j 9u<&6jV5<h h jGSh h j2}n=<ueVWh j=uVWhì A =W3>SWh j~1=uWBe[^_U(WVSujVh jtb>t]`=VV=Sh h je|2-0=jV=Wh h j3 6E~DS]SWݿVSh jEEPh EP\ nvt7uZjEPW莿Vh hD j~2UډU0jEPW\Vh h0 jtEWCuh hV jKE܍e[^_U WVSuj/Vt@EPVjz -~Phh~PV#SVhk j~ ƃ~P61Wh~Ph{ jt3j/h~P)~PtP(jRh jQh EPƅL t5(h LPi EPha h hNWLSh j tgLt^Sha h hjhh j hh`ujh hŭ jha hڭ S谿jhh jI jSh j7:h$S{ƃ5<Sh j=<uha >h =ha >P:Pؼjh h_ j96hC ]Sоj SVShI j`(V;h$P:1ۃ =unCfhP%t!t;=t2hhh =tP91=u[^_Í6US5hhw j=&=hW9t(Shh j:Shh <7<h/Shh j}(=<t h|N<hhή ;=t^<h辺Shh j}(=<t h|N@<hh 6;71]U$WVS}1ۃ=t 16u h h7 juV5U} u7}egVj5荽Sh hZ [6}|ZMeEPj5WSh hf jO'jh hq jX؍e[^_Í6UWVS}u ]=Sh h jVh h j  Wh h j=t=%Rh h j5h hȯ j =t#=|55j4==t5;Fv5=td PVh h֯ j1t =t=u=tPhMz2=u MhMjj=u%MhMjjo6= u7%MM% M%MM% M6v =u%MhMj5 %M%M%M M M%M%M%Mρ M===u M@jh h v=u%Mjh h je MmtFet_otst2R%Mjh h $ Mjh h  jh h: j %MMM=uMhMj5z|1e[^_ÍvUU=} Í6=t1ÍvBvuhMjR%M26u Mvu%MhMjj hMj5ø}UVSu] 5h hX j5h hc j Vh ho jSh hz j =}-9 v=t1)=tKjh h j6=|5uǃ=~5j0맍6=t395u+9u#9ujh h jv=t'5謰ujh hͰ jY6jh h j=tH PA1t =t=u=tPhM-CvuhMjSyu MhMjjY u7%MM% M%MM% M uhMjjf%M %M M===u M@jh h =u%Mjh h j1 MmtFet_otst2R%Mjh h $ Mjh h!  jh h: j %M%M %Mρ M%MMMhMj54 |15jh hW j@ve[^UWVS]ESh ha j5h hl j 5h hy j=|=t=u =t1 11|z 93 v v6<x] B/vxv-Zv166666|tl d \ T L ? 80( Euh h jVh h j }ujh h jo6uhM5覯Sh h j>VhM茭WhM葬VhMvWhM{ VhM]WhMbVhMGWhML hMj5臱Sh h j|e[^_ÍvUWVS5Wh hɱ jU5e[^_ÍvU1vQ@?~Q2QKQnQQQQ,QXQQQ` QQ%QKQQQQQQQUS=u^=uU5h hѱ j'=}hN腧Sh hޱ =6hM5D} vhMFSh h jSh h j -w[w(R6*6w)   vwv126K6n6~vn,fX^VN` F>%6K.&Sh h% j؋]Í6US1ۃ=|CÅ 06؋]ÐUS] Sh h2 j=8uBC=w850h h? j=0~ACPU8u E650hR58j 0<SuhRO041]U<=t#=0~#50h hS j=0 0=t50h h| j=0045<h h jm=tF=|5u4=<t+=<tr5<h h j/jR6=u9=t0=<t'=<t5<h h jj=0}Ð 04RÍvUS=t dM v<jh hò juhhRS9Sh h jQ,5h h j75<h h j ؋]ÐUS]=t=t =5t=s=t8fjh h/ jh 5PyShG hJ j,C$dvvDL$$j66= @t3=t*=u!($jh hc jѿb6=@uU=tLjh hy j裿#˸-#jh=t=ujj1]ÍvUS1ۃ=t=t =5t=u=t8t50h h jtJ=0~K 0y44Rjj$ƒRh h j@Vh h j. =tv61jtjtSh h j߻~1uu 5h hƴ j蠻e[^ÐUjh hմ jxjjÐUVSu] jVjjh h j?hHj$5h h j5@h h j =t>=@u5jh h jںjj蕠jj茠 jj耠^65@h h: j衺Vj]Sh ha j臺(=@tSjj3= t  e[^ÐUÍvUjh hq j6jjhj jjٟjjПÍ6UWVSu} E=t Wh ]S.VShx j̹u=|EEENty=tp=} .=uS=tJU~@utUFACExtACލ6UU޿uO)Ph hh jĵVuuLÃ9u/Vh hq j蝵}u茟v}p5<h hy je=< to=t/=|5u&5<h h j0j }tuQvSh h j])ރj v}tuΞEe[^_Í6U EE=}Ã=t hM vUhj3jwE }Ejh4M*h4M=mE~ P-=jEPh h j=Djh h jгj5距Ph h j豳 jEPu2 ~u螗1Í6u苗5<h hɶ j`ÐU WVSMMMMEEE=} vu h hԶ juh h޶ j }}}E}t.hj茘uϖPh h j該jh4M~h4M葖tjh h js61EEPh h jM=tE=uE1EPh h ,<=D~% DMQh h jڱ6 0y44RE}=t.uh h' j脱5<h h? jm }u(=<KCSh hR bv}&=jh hg jEjD}u^=t=t =5t=u:=t8t1uEu aM}s=tt}}xY=uh=t_E#9uNF95G}t~=@%Ph  vh 1}u3U#UE9tuh h j֯6EM" } ;C}u.OɉMEQh h i6u}uMIɉMRuL}uF}GEMA%}|8}EWh h j u>MD %?v)PQhӷ j߮}tv}E@9}tE9E=UE9t~uh h jjSh h jX =0~eujE9t"Ph h j(=036=DPh h 6EPh h jM ==u|SEPQ. ~ZPh h# j蠭juh7 j菭1 9} }$8@9|juhK j_ 6}t};Puh_ jE H9KEe[^_U SEH=} 4E=t=t =5t=u=t8tE=|45hi hp jyEE=t/EP貺~EPhv hy j-E}~ =0~A 0y 44R~ }1؅9.hj茑uϏE jh4M荏h4M蠏tHX 0y cv44RSh h jL]|}k}~=uU)U}}E}tuh h ju=tu'<k~ }t ؅|#]ÍvUS]5h h jz=|V=t jI=tj09C=w*Sh h j0عwP5Ό]Í6UhgÐUhWÐUWVS]E pMU1 ]tM<hpMjjRhƃ|E5<h h޸ jz]Vh h j[%v5<h hʸ j51t[^_US]Sh h j~عP ~gSh h jШhxMhpMu|FpMtMhpMjjjjPh h j{1v]Í6UjҏÍvUSj轏+Sh h0 j/؅}1]Í6UjhŎÍvUPVSjEP譎]+E+ƃ}K@BD V<$S$]L UfEu]6؃=t#uuh7 ]SݏjSh: jzEe[^US]hxMhpM~w9$ƅ1<619}69}jU C9|v4lWju qe[^_Í6UVS<==u{=t<uoƅ} 619}#6jM¡0C9|߉x0tu  xt5Hdh hֿ ji=Hdt =u$5tmtjh h '5t)q=HdtQ=tHjh h jj5tsPSh h jӉ(5thj50Tpx=tP50h j茉=x5totBjh h' jW5<h h6 j@=< ukdv5tktjh hD j5jh hb j60t xte[^UWVSu] Vbǃ vt;t=t=u w1^u+0HPS5uqPl064lSq1u u 5ke[^_Í6US]u S<|R=t=uvXujh 5pPRl84lh qu t u 4l*k1]ÍvUSE]=t=u w)vSu 4lhpPk9uډЋ]ÐUS]E E=t=u u$jEP5 pPrk1҃tXQlB9BwEPR.it8lHU@u4ll1҅tv1]ÐUVSP@ =t5\h h jA=\=t&=u=x <u\65P=\5\V5xnPbjà ~(=tSh h j詅)\릃=t)5<h h j|Sh h jj\1e[^ÍvUE v!tPh h j*Ív~uV3ƃu >uމ=uS 7EPdƃuhr hx<}SVb]~v|/tKSh h jv3.DjV jE}5<Vh  uVh j<V7k1}}e[^_Í6UVSu= t V"gÃjVh j=$~W= tNhhVz8jhh j諀} hh  hh j;h؍e[^Í6Uhjju uÍvUWVS]DžDžDž} u jSh j;~uS1u 8tƅ޿  %un}u,PShPeTvu3}t-u$SjtSh PgvhSPZe EjSh j*1Džhh h" j tF68F~;t6;/tC;uv;/u1CG;uhPSdESh: j~~}t tuPu ndJM tv9 \~h; v Džu; vE<DPt <DPtC;u€8 w!6M 9v: vM 9uH fL fAN AIu?M 9t1<DPt 0=8uju hO j }[^_UWVS]1jSh_ j|u M  h~;~uCjShm j|ڃ:t%:/u ~16FG=B:uM ~jh~h jl|e[^_Uhjju uÍvUWVS]uDžT\tNjSh j|ƅu/PShPaEk6jh Sa uvjh Sa uˍvuPhS13vhSPra jSh jF{}uuSu Ea~169}tPшƒʉ<DHt<\6~u-P6#uXD6*t?uX3 u_(6wX6.u_6CFG>Rt .u =~.uXu Fuh~V@`ju h jz[^_UVSujVh jyt  t>uXjVh jyV+Ãu ;ujSh jyS^t1ve[^Uh O[u Uhh h jWyhh~Lau ÐUWVSu} VWh jyV} 1ۃt tCSWh jxtMh$ WYl\P@ K6EP\tjh h Hv^t jNa65h h) j1xu bjbjh za jau_jau_uah3 YÃu-%P_ƒtB8u ! 6Zމڀ;tB=t5=uh@*VtNh5V :=uh@Uth5VT v1=t1=~50hJ j5h hT jr[^_ÐUS] ~0SZS@PShb jIr@]Í6UÍ6UWVS1EEEU:tvBFG=:uM EvMMU)E9} ))Ǎ*FNjhhh jqhSSh h j{q$768.u x~ujj jP>S9E}EKċEH9E}7jhh jq]CSh V`YM d E}M 9u4jhh jph VYdM hSÃt0ShhH( thShV SpZe[^_UWVS1ۋ} juh jEpjWh j6p =t = uau M%E0ۋ} щN} ҋ}щMʉURRÃu 6u SPE |/th SgTEPuuSOTjSh jjo jWh jUoWuSƃt=$~k= tbhhu&hhW&thhh hhh j~VtSXe[^_ÍvUWVS]} މxDžpjVh6 j}njxhD jin =t= t r6EPVjQ uEPxjQ uJfEf9u=E9u2jh hR j65<Vhp jmvhhSu% tjVh jmhhWC%t Džxjxh jbmxVUujh h ju 1 6=$tEPVjM EPVjM } c vfE%=`tP= t? =t^d=@t%[v=t9 =t(F6=t-;vd6vc.vb&v-vlvsvpv?CEtr-C}}w-CfE%@@t"t.6=t=@t-vxvSvsCE tr-CEtw-CfE%t"t.6=t=t-vxvSvsCEtr-CEtw-CfE%t"t.6=t=t-vxvTvtCjhhq j he[^Í6UDWS]х}%)t } ЉCC =t+hK0҉ψщHC C C CC CC  C$C( C,C0 C4C8C< C@CDCHCL CPCT CXC\ =tEPhjWJƒ fE%Phhx jffE%Phn hN0HCPCT1҃EtB}}E@t CXC\sPsTh jfsXs\h jfCd C`ChCl CpCt Cx1e[_ÐUWSuh h je}|%URqLǃu jh h je v_Sh h j_e~Sh h jBelSh h j'e w ww;w;v1Pwww G@PSh h8M0ЍX Shh5 jd~e[_ÐU@VSu;;~uSoÃu ;u5$Sh= jHd=$tEPSjG6EPSjGƃ Vh hD j du u25<ShM jc e[^ÐUWVSu uh` jc} t} uEx u x :ux:tu uhg lu uhz jvc1ۃ5<vUDVC~u uh j>cC=M 5<DNtEDDFuu uhg ~u uh jbLjh h jbE1ۃ UT+C~]jj jSDVSh jb{Vh h j]u uhg Nvu uh >vu uh .vu uh vu uh% vu uh9 jbEudӅuӅuENǍWujh h j$W1udž}uu vMu1Ҁ;/t;t2CB;/u2~;/t6;tC;/u;/uC;REe[^_ÍvUWVS}Wh4XuWh j|Vj54h jhV(jPh jQVWƃu+Z50h h jV?/t ./C1ҡ48tv8/uB@8u8Rh h jU=,ur=02~S0Pv8,R0ЉЅ}lj=02=02h hx<#a,M M ShVD tV?ރu5h h jTe[^_ÍvUTWVS}u!UBju h vF6u Pu h? jT5854hR jlT$juhd jXT=u t u}MUuN19u w>/u @98nN9u v5jV54XSVh} jS ju h jSu vju h jSU%ER)Euuh jxSuuh jfS$=~u }uu&40}ЋUDEEPu j6 u8ju h jRU/BURu Uvju h jR6Uju h jREPu j6 fEf%f=@~ju h# jURu 9EWvu5E6hE Ph$8 1t FO)ȃ t4 thu20ЋU\u Wu h7 jQuuhH jvQ,=u"t}u}}t =~st\EPu /E8.u =/5jhu"Utju hZ jPu Wu h jP5jhuTVhh jP t,u5}u/ju h jPu 5='U:/C=~~t vVh50ЍP19}<3/t3C9|ƃuPh5ǃuVhZ.VhO.'VhA.wh4.3Ph2e[^_ÐUVS3Åt!}huVr29uER6臰th 蹳h'6vjuhB h h! .h! 聴h5ve[^ÐUWVSu2Åtjq5h3 6.u,茰%P-4ƒtB8u! Jˉʀ9tBujh SQC.6jVhB SQ-.j4vuajj1Ejj1ǃuvV19tuujX1WjP1E}uh}%e[^_ÍvUWVSu1҃=trVÃXteh.WWV2ÃW57<\u u$u<*t G=uw=@u #  v@@PV$ƒ=@t@@8tPR &t,jh h& j->@L_v@@ P#@B P2#@X =0tFPh4 h<&5@0h<襥5h<h= j=(=\u襧==<t <vSh<><jShH j9=S}5<Sh[ j<h "}5<Shu jljSh j<S!}jSh j>vjSh j<@@PR&}#@@Ph h j|<@@Ph h jY<`=tj \hVh`6"D  =$= Vu Ph j Dj@hLh`!@0h. =$t.= t%u P@0hB j #h5Dhh!hLhO h#hhLhW hYv#(hYhhb hNU#hNj@hLh HPP L1e[^ÐUWVS]=\ujh h j:6u 0ЍpVSh jN:UUSh h j$:\ 5h h j9j55h h j9(~*9s5h h0 j9Wh hF j9UUe[^_Í6UE1UU=t'4d4d=0d0d0dPm1ÐUS]Ph hW j8"Pj裱|1"4jh h^ j8]ÐUEPÐUU ÍvUWVS]E =t=u=t3jPS5<h h j%8vjh h j85d6N9u?=t6%  1h9u;NڃBv?u@ۉڃ6ڃvu uX=v=t 8 @   و@ \\9X[18 =tA=u83 31  =Og1e[^_ÐUWVS]=0u=4u =8t5} u,v5<h h j5vjh h j5=dpO9u?=t6%  E=tE=t&9uuEO 6E1h9u<OڃBv?u @ۉڃvڃv uX==tE!%vE ؃=uN=t}u?uvuul ]=u =uP=t 1=t u=Ht }t=tP؃} ==t 8 =u7=Hu.=\t%=8 uC+u S+N;@   و@ \\9X觬18 =tJ=uA=u83 31  =#=ۍ6=uSM у} l8  =61e[^_Í6U=t Ív xyÐttU塤uÍ6USM=x.61-tv$%9uB~]Í6US5h h j}1=} Z5h h jP1Bw\\~=u\+\~Sh h j1} Sh h j0؋]ÐUWVS M1=t=u =t=%Puyj=\ujh h jt0D6\E=tPh h. j50=]8 =t xxt0t诤ƅu8+\Ph h= j/nd6u#jh hR j\/0jh hg j9/8 M=t@=@du73 %31   M'v=u=u1=t?E=~vMAMC ==u+\==8 9 8 A8 )Ѝ9~E9u8 8 6 xxt0t_ƅ}1uM 6u]0Q8 =tA=@du83 %31ȣM  MEE=tCM8Mu;=u2=]}=^uG  M^(=~(  M  UEf 6 . &h0f t v 5h h jjh0h j r=t So{,6=t!=u=tSjjj =t=tjSWj!5ӥ1=u =u=~5 5蘥jSEPXo =t|=tjuh j=tV=t%j =t Ph jk=t=tjh h jCjh0h j-e[^_UWSEE54h h j4LSh h, j }'4P股Sh h4 jWQ0҉ψщHP54EPfke[_ÐUSSh hB jX~ S ju]ÍvUWVS Xj5,hK jjh5,=uY X:uc fg fBi B5XhX8~uPQ8tP5X9=tu\=u uJEPXP uXPt j 1a v6=t&=u=t5Xjjj<j5Xhx j=t =tj5Xh jh11ې =t=tjh h^ jO6hh͛=t =tj5h~ jjhh j j5h j  6 80jh h jo =K=>jh h j?#6hh jh h j t6 ==jh h jz6==jhh j6jhh j tn- =t=tjhhV jS8&6 5\h hq j jhh j j5h j  j5h j =\uJ=tA=t8=t&=u=t5jjj 54=t%=u=thjjjhu9=8=jhh j h}Xjh h j =t=tjhh j 81,6~(=t=tjhh j=thhhHKwhHKhh GOhHKh juh' j jhh2 j 8 l40 ~axa|}U Um$XmPh h@ j l5l/e[^_Í6UWVSu} 5\VhO jY 58h h[ jB  =8tvjh hh j =0#t=0t =0?u 5h hx j`81Pv=tH50h h j54h h ju j5,h j^=0u,8D%01=0u=4uu`5h hx j1=0u =4tPSh h j}=t`=u=tjWV詧 =u XSh h jh0؍e[^_ÍvU840蚈UWVSuVh h j =xt!lj5xh jc}'1CƅM=u  PPh jo5h h jX = ==l=tD=t;1ۍ6<t-j5th04 &C~Ƀ=tC=t:1ې<t-j5th04 C~5h h j~5h h jg :tg=حt,DžPPRj&h5P! jPh j 5h h# j5h h1 j 5h h= j==t115lh hM jj5xh h\ jS =lu =xt1Sh hl j%Wh hx j hSWSh0谇u5lh S/ jh0h jjPh j =xDžDžhft}j5xh j_PP5x$Sh j3,hh iSBSh0S jh0h jjPh j h0?=u7=u.jh0h" jh0h@ 5T=u=~5Ϲ%jhhd j+5h hs j SZ5\554FtXPW$TE===u =th054jFj!=tb=u=tPjjj=t2=u)=t h uPjj0Whh0 t0HPSh j=t=tjSh jSh2=t!=tjPh j=t4=9=,5h h j v=tQ=tjh h j=t)=t j\@4h j=H==tjh h }=t}=ttjH@4lh R6=t)=u =th54jXj=t=tjhh j1l5l8 l0VxV|ٽ ٭$X٭Ph h j5xh h j[^_Í6UWVS5h h jW5h h j@ =u =ta5h h) j 94650h hw ~5h h? j=>vWh hM j=dt4ByB?$)‰4$gZSh h] jG654h hj j%!=0u =4t=,=tK5h h j5h h j 5h h j=t/=u&=u=u5Ã6j57Ã5\u 1>6u849-jh h j1v54h h jSh h j S5\h jVS54jDQà =dt 4=CSh h ju9O=de[^_ÍvUEu 8t"Pj54jZP X`vh j54jZP|8l1Í6U54r| uoÐ54h h jÍ6UW}54h h 654h h jMu USCWSh h* j#}Gh j54jBOÃ|'840@{1؋]ÐUWVS"EPh h6 j5\h hA j =\~U9\} =\}uh hN jZ=^~ ~ j5dM  e@g i}*tJ tA6tt"3=t*&&=t 5h hY jJ5h he j3 =u N6==}v=t 0B}=t+=tj }7>v1=t=t =t =t =t  } 0v=t 0 !} Pv=^~ J_  }[0___}51Ƀ=tA=t=t=lt-=lu =Pt=u=lu =Pt=\t$=\u=t =t =Pu 0ҍJE9|t~  6CF;uƆ=t5jhhr j*0HPhhhTe[^_UWVS}Ddhd dMQh hw j5`h h j =`~M9 `} `Muh h jUjWh jFO }~ _P M=t 9} P=lu&}~ _h| ` 6h`5l5`EH`|d}~-G%|}~O@ d vd=|t+19|~!6dP#FC9|}~O ff =ft =fvf #}~_C߃vCw hh#}~O  v=Yu 3߃v w 65h h jG5h h j0 5h h j5h h j t* tvtO6==t =&u|&fv1ҡ9t =Yut<Ph h jM=uss=uN}~!Bu_ЍCv}~\W =tF=<Yu8ju?3<v<w"҉ v=t  } q_ Sh h j 1t =t@1t =t@1t =t@1t =t@5h h j5h h jw 5h h j]=t"1t=t =t@5h h, j5h h8 j 5h h j G t 9u|F>uVh hD j5h hK j=F9E~}\7ۍۍCD7%Sh hW jU=t9]}E@# @#=  P =t=~ 5h hc j5h hy j 5l5`7B`=9u\7Sh h j` 4 4 490} 04=4 4=4~ 49(} A (Sh h j@4Sh h j54h h j =4~m5545(à 9~I =t=~ 5h h j)uh h jF9E~%D7%DdPh h jDd DdtK=lt$=lu9=Pt=Pu'=uh hpPh h je5\h h jN =\~ Dd X5Xh h j=Xt j5X`F9EMT7 ҍB6D 9E)RD> Ph = h:h=t=tjPh jf=-'5hh3 j:A 1t FO)ȃupjh hD jffffffffff= u=u  =tu覺81e[^_Í6UWVSjuh` jI=u=u=&u =9uvƃu 0ЍXSVhk j=t&hVjhh| qv=t#hV\|jhh B=&t#h&V0~jh&h =9t#h9V}jh9h = =~ru"dSh h j=~95uh j=~9|5uh ji=tkj5tuh! tOjuh, 5vSjhG ja^S4Lhb jHjuhw j71Kv1ۍ6t'ShV艌jSh j * jSh. jVhS$t VSNjVh< jB0щ\ PPVhJ he0щHpt$VmƒuBVt5{/uh` hb RujPhe jP>_Phj hv jc= 0H=Rh h^  Sh h jpt؍[^_ÍvUWVS9= P_uS@N0Ѝt9tv>/t N9u>/uF~SPPt5Vh  65Vh h hw5Vh hҹ^=u{5 =u P5 =u P55h hx 0H9[^_ÍvUWSE8u 16PSs5Sh h詸0HS[~p   f$ fLѶv[_ÐUVSEDX=t=tjSh& jgSNUUjVh< j==\tw1ۍv44K~X=t!=u=tVjjj=t=tjVh@ jͫvC~V5\y.=t!=u=tVjjj=t=tjVh@ j[5jShU jE=t=tjSh` j!1e[^USM] ti9td9t AB9uCBujhh~ jhjT$jhh j1Wvjhh j}X]ÍvUWVS]%C4Fjj jSWSh jjVh j |= " $vl,,,,,,4,P,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,l,,,,,,4,P,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,`x,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,4,,,,,,,,,,,,jj jV0($vjj jV84jj jVjj jV0,jj jVȩ jj jV谩 {jj jV蔩@<_jj jVxHDCjj jV\,6jj jVDvjj jV)ȣ6=t = :jj jV֨ǃ=tu$=u uu u =\P6jj jVh<86jj jVP 6jj jV8 6jj jV $6jj jV(6jj jV,6jj jVاBw 6>B|6jj jV蔧=@#~ @#=^~ ^55,Rjj jV@5lRdjj jV ƒ^Y(6jj jV…6Xv19D~#lV[t 胬t C9DSh h j9D[tHu=vHP \lGjj jV(…uBwj05R5T6jj jVإ…t6jj jV败\61e[^_Í6UWVS]} u=Hu`Sh h j~Wh h jl Vh h jWCǃ9~XSh h j0؍e[^_Í6UWVS15h h j5h h j =t ==jhh& j5hiu< t? uSh hB jVt'=ue[^_ÐU=`t^` 16@?~`<UWVS] `<0=pu 6=<} ~  ~ 4v6~~))ShP hQ l5<hP hZ jShP hr j`6 ~  4~$~))ShP h j jhP h jv45=u 5=~ +=)+=5 hP h j=   M=   5 hP h js5hP h j\ @@< =@ <*=@? <B<<‰<=t =@dt=Pu=<~<<9t~ t<=x~<9x}'x=xu`9<~<5<hP h ji1e[^_ÍvUWVS1EPhP h j15DhP h j 58hP h j5XhP h j 5@dhP h jϽ{ ==D=,~a4PhP h+ j~4hP h7 ja ~vҍT97/ǃeu$vWhP hl j/ǃet߃=t,Duj'5,h jW5,h jټz}L=?=2=% u Rjjqj6N=dt"QtTuHh L EE Q2H8<,yS?$)ShP hB jE59VhP hQ jʻ<eVhP hW j諻LE| @M ɉM| u'VhP hj jmV_EvFyV?$)9f}l5hP h~ j!5?h  T<85hP h jԺ5hP h j轺 iƅ) 55hP h jxh 3 69u:=pt=`tR5D5hP h j 65hP h j ShP h$ j T 5,55IShP h j蹹u-=du5953Iv}5I=d = 5Izh # 595^6<6LE| @ME|uVFyV?$)95u=dtI=8Du@5dhP h j裸58hP h j茸Y }l=,~O<t?ByZ?$)‰YHPhP h j=dt =8Dt }*@臚}z¡9~P*WhP h jW5,h j誷WhP h) j薷 *ǃet߃zV }M=t0=u'=tD u8 Rjjqjש » 'NI=dt"QtTuHh EEQu!H85jƃoT885hP h j蘶5hP h j聶 54Lv|DmD  5hP h 06E5,55E5hP h j͵5hP h+ j趵,ShP h< j衵Yq=< 84LVhP hN jUv\ShP h\ j&D_9}RhP hm j=tZvҍthP hw jŴt hP h j諴 5<hP h j葴v|uAT 9}29} 5hP h j;=t15,hP h j5hP h j =tA9|4=@ +=8u" ɉM QhP h =<~G9}7+й]uhP h t,@E<Й}ud=<~[9}K9~>+й]uhP h j9}PhP h j農=pt=`t55D5.B5k@9u:ByZ?$)‰УPhP h j65hP h* IvuG=,>85hP h> j5A5wƃ|5hP hZ j蹱5RA6N8=dl5hP h jq4L~Mvƃ|2Du8D2  5hP h j5@u^jhP h jL|~[؃| u 565EƃM64Byr?$)9=,~CRhP h je5ƃEh >65hP h j?=t5Nu!=8St =8Iuj5E65hP h j譯Eh '9WhP h0 ju=,u$=dujhP hK jME=@dX @d6hw 65DhP h jhT 5,hP hh jۮ5hP hp jĮ$54hP hw j誮@E&vh x5hP h7 jyh` 765DhP h, jjhP h jEp@h 6Eh EvRhP hL j@D,|0։Hd|@jhP h j衭qw6=8Y6Ԑ5(hP h j]h SE)XXWhP h` j+=<e[^_ÍvUE=ti=t=5u =5uN=u =t8u<mt"et-otst TÍv ÊT4%Ð%ÐU WVSu}] WhP hu jlPhP h~ jWM8 F F Fx 16"F"FF} m^NMNMU8Tu@ӊF8Tu$UF8TuъF8TueIU8Tt6ӊF8Tt(UF8TtUF8Tt ove[^_ÍvUWVS] 5dhP h jA=dt 1 6uhP h jShP h j 5hP h j5hP h jͪ qÉ= Dž~uu)Ƌ M9~]ShP h je9}9ؙƹ Ã9u}uuhP h j%Ee[^_Í6U WVS}MMM9 \%E=tnu hP h jթ}Dt(\PPh j蹩uuh j觩 WhP h j蒩uhP h j~  M^%E5\uM LM=tOVhP h" j'uhP h/ j }} =duu hP h@ j}~$MIȉtM LML@`M NMN}tPй_F  F VVFFFF‰%$? F"V}t Ot6M3AMCOuv3t0 tt7tf؃PFP5 o؃PFPU&6؃PFPi%  3C$? 3C$? "؃PFP $?!3C$?!3Cڊf3C=u_=t =5t=uD=t8t;=f u2=5t88t ~t 363 C3=u=tRVu jsM'=t}mt3 etj6ot7stN\T9rTTJ9sB6T9r8 J9s.6T9r$T4J9sT9r"J9s=Ht5H1=|t=u5|h5ǃ=`~=}Nu(} ~ M  cM @}~MIȉ\ =u=ti]=tEPhP hc jS15@Vtǃ=WhP h| j}i=tW}R=t%=u=th jjjpZhhD 5TɊ6@9}=t=e }U Um$XmPhP h jWM 8< @  @ 4=t4u Vh j=tR1=t@=u}Dt}Yu1t+=t"=u=tVu EPjD@e[^_ÍvUS]U 16CJ%?ȋ]ÐUSMU 16AJ%]ÍvUVSu] 1)1%31FKe[^ÍvUVS54hP h jآ5hP h j4CyC?$)à ShP h j蚢=du^5,5ST2VhP h jht 26S.}PhP h j9 641e[^ÐUhP 5ÍvUWVS<WhP h* jS/S-ƃ}ShP h> j輡hP jSjY|HPhP h^ j}~ W/0~VM/ByB?$)‰1e[^_ÍvUWVS]} SWhr j MQhP hx j S.S,ƃ}ShP h j٠W0HPSjY|j5hP h j蟠ShP h j荠 9u4}~ u4/~VR.ByB?$)‰1e[^_UhP uÍ6US]jSh jS5]ÐUS]?vShP h ;vShP h jڟ L}+S+}ShP h j譟1> LIʋLD9 (|hP jSjN]v]Í6UWVSuVhP h jF5,5V /Ãu=Tt| M MhT0THPjjYÃjh Vj# M M hP jVjYEÃHD=tM=uD=t;h 54j%j诐%VhP h jShP h j1ShP h" jڝLD9 (} @d XҍthP h7 j聝$.| ue=DlVRD=t&=u=th> 54j%j趏Dv=t]=`~ t tÃ=t=el }U Um$XmPhP hG jShP hX jjD=t)=u =th> 54j%jƎҍt tVjSDe[^_UVSu4\djVht jқ=t=tjVh{ jx=t!=u=tVjjj V`5\554jEJhV5Tc5   S58W5 =dth<`==@dy=l=, =dVEE5,hP h j蟚===h jjjE]M]EfE@t2E }U Um$Xm<`؃=`<`j2a ÃTtBzt==t+=u"=thP 5Pj95=t"=u=th jjj=@d @d Xe[^Í6US]u ^|5\554P]Í6UWVSEEE \M M\5Tu(\ jhP h j裘 MPRh j耘6]Suh jg$}urjhP h jCM M \5Tt!>t 6^VރuT\& j6hE jԗuvE\ES5\hT j覗]\)6蔁95TuFTV{5T vMq}@=Tuij%zƃta5Tjz f| f~ B0HPRh jF?M \M juh j贖5XhP h j蝖 XX~}\ 654hP h jU5\u54jO'à ShP h j(}%\ #V\` }@ShP h j؍e[^_Í6U WVS}u ]5hP h j諕WhP h j處 VhP h j脕ShP h* jr 5hP h6 jX5 hP hC jA j5hP j*\X=u P 8u\] jhP hr vEE=jwƃu\ jhP h 5h EP|0}ЍX ]P9wu\ jhP h eEP6uF=Tu5Tu= jvƃu\ jhP h 5 h EP|0}ЍX ]P}vu\$ jhP h EP6]tF=Tu 5T6Uru0=ЍX9juƃu\@ jhP h\ (CPuu*\r jhP h jŒ-v>FG^~Gع_ G G5WysF=Tu 5T6UrFR5W}\& 6t8=t5\554jWZ5\554jHC6=t5\554jV"5\554RtJPÅ} \ ؅~1e[^_Í6US] u=@d t =@dw =g u 8au,`PhP h j+68g=`PhP h j``-]```hShh j觐`tTuShh jz66=`t)``-] ` `1]ÍvUU=t1Ðt=hu dhh8u4hh8u.dhjhP h j׏ádh1Í6UWVS]=u=@u =@`=SPJt#jhP h jh=J  P=HH$*6\+*+,+*D+=J  v=JC  v=Jl  t6=J  ]v=J  D6J f fB B 6=J e[^_U WVSutx0}ЍH~_F8auTFҊF< uC]FStIu3B9|,t]E%EAPE@P 9Et1]}Sue[^_ÍvU(WVS54hP h jdo} z 6oE} 6MIʋ],d=t M 6g]jhh jČ=51=t6BFG:uWaP55hP h# j`VhP h7 jN,~95t5z6=tS5`hP hK j5<hP hX j 5dhP hf jϋ]܃=`u-=<t$5<hP hv j蛋<5aPEP5<MIȋDHP5ǃ=t3=st*=t!9t =tOWhP h je }U Um$XmPhP h j轊  WhP h j蠊uX}T5hP h jy5hP h jb=t =t 6=Dt]=tT=u=thP 5)v=t)=u =thP 54jTjm|jh jjrN =ujT& =D=h=@x T1D1D1D1Šȉ%Ѓ?9tOujh jjr ===h vD:% H D:%+dyv_WhP h j艈uAjh0 jjr$=H=;=.h? x+d1ЉF=tdDPuRjrz?vqPhP hQ jӇu=tjhk 5jr3==u=hhz vEF98t=DtBNu=uhP h j=ujh 5j#ev}It}SuEdHdC6}Nu2@E؃EeEd+Eأd 6]؃=t.5hP h j苆uhP h jw   ,=d][9|}9WhP h j3Sjh 5jrQv19u~>D.F9uD.}u0=uEjhP h j踅}} }t#6}2}svE؉VP9=t`jPh j/E%PhP h j VP^PhP h jujh jjrY===h# uE% ƉPP9}EuJEGE؉PP9hO=t[jPh jVhP h jك PPSPhP h j譃ubjh2 jjr=i=\=Oh# 6] E% ÊE% ÉPP9b}EuYEGEGE؉PP*9=tejPh j萂E%PhP h jt PPPhP h jHujhB jjr===hR 4uNE%H ƉPPW9}EuJEGE؉PP9D8VhP h\ jVujhs jjr$===h# Hujh jjr|===h 54j%jJs5hP h j虀4tMDPhP h jmjh 5jr VMID=`~¡][؋ T]\,T=tZ1=t@=u}Dt =8Du1t0=t'=u=tu5EPjrEe[^_ÍvUWVS} u]]=}&<REPh EPg%<RWEPh EP^gU0HPRjn | j%t;vVh6 hN jt=u =}#jh6 hg js19 ,6< Iȋt LD D Djh6 h] j4s\G@d tPP9L}L6A9 ,;e[^ÐUS=u =} 19,~w6<ub[ڋ 5h6 h| j[r@dtPP9L}L6C9,]ÍvUS]Sh6 h jq?v L~89 ,|0L@d t+ P#v4Lh6 h jq>IʋDD D D]Í6UVSu|95,Vh6 h jqv\Sh6 h jp?w <t7@dt P5h6 h jpvDD D De[^Í6US]Sh6 h jCp~P]ÐUWVS]u }Sh6 h jpVh6 h jo Wh6 h jo?w?v lv9t17?9}9}!)~9}97?~9|9|10v9}"6} @9| v9} 9|e[^_ÍvUWS=jh j+Gh j.19,v[tttt t44ShV hW(hj[<|:tT0ɋ|:It76 H~q R[thu hVh h hVhjb|8C9,55h hGVhj'} 1e[_UWS=@h jh j19,[tttt t44ShV hU(hjq [ ىM0ɋE<I6 H~q R[4hu h$Uhj|8C9,455h hThj} 1e[_Í6U WVS] EESh6 h jDluf= t`1ɐfM A^~{: h Sh6 h jk=5 h6 h jk=t#}   } .1ۃ=@E.f= ur 9 |_\.  =\G19 ~v\ CA9 EE%fE E=8E"f=  )؃~t\"Ct"\"C\BC\8*v\#C\AC\MC\JCEE%fE vE=8 E*f= =HuA )؃\*C\!C\ACEf 6H@xEuE6 0}эq~a )ڍA9|JE=\;C!=\;C\CC19}v\EECA9|EEvE%fE }t == ==uyE#f= uk5 ~a )ڍF9|O=\;#C =\;C19}\ CA9|EE%fE E=(<f= 5 h CE\PP=\0҉щMN )ډ@ 9|,=\;! =\D]Ef  \E=(f= 5 h CE\PP=\0҉щMN )ډ@ 9|+=\;1 =\D]Ef  \E=PE,f= ut5 ~j=ua )ڍF9|O\,C =\;C19}\ CA9|EE%fE E=XE-f= uu5 ~k=ub )ڍF9|P\-C =\;C19}6\ CA9|EE%fE E=0=f= =5h CE\P'N=\0҉щMN )ډ@ 9|.=\;( =\D]Ef v\E=u =L= E+f= 0d֋ )ڍF9|y\+C =\;C=t \P \MC1ɀ=dtv\dCAduEE%fE  \E=uFf= u< )؃~-\+C\!C\RCEf ESh h j'duh6 h jd uh6 h  jc}t}uIf= u5 )؃~)\@C\ C\Ef }u1F\u5\h jc\0ЍpRV54jAFe[^_Í6U=0u& ÐUBNuNV|jPh jb=t=tj5h j?=>1^ۍ~Sh6 h jSb1D4GKVh6 h j%b~55h6 h jb=~5^|9=u&=t=uh6 5jjHT6 1e[^_U@WVS}E E0=\u=t=tEV NEW W E=uL=8u jeD8u h  68P8@8U BLBHMGU؉U6GEԃ߃$ YdYYZaaaa[a[,^Haa$`ap``19}6' D+GC9|D+9})jj ju:BM 719}6  GC9|ƃ 9})ǃ=4U B ZSh h; j_5h6 hK j_  <vV= ItMEMԋUȈ BUȃ===ujh6 hX 76M A8Aujh6 hg jU B8B+jh6 h jj19}6' GC9|9})ƃ =M A Y =\jQu UԋMȈAMȃ=u(=t=tjh6 h jm;E\619}6' D+GC9|D+9})ǃ=,%jj ju @U B4 v19}6 B GC9|9})ƃB = M ADB Y@ShB h j]B At CtsvH19D~'lhC [t 'Et C9DSh6 h jA]9DunjhC h j#]=@EUԋMȈAMȃ===jh6 h [tHPh6 h j\5\h6 h j\ =hu4Hw*LC+w\Sh6 h, jS\HX\lG"jhB hB j\=@EMԋUȈ BUȃ===jh6 h_ 6=8u je>8u h 019}c8GC9|89})4=B8M ALYHEEf( fV * X 5hV h+ jPVbvE854h hX v>V 10X H W jhV hC jU}u(=8tfS fV U X EU ǂV 0V H}}48W 0=`t`\`uhV hV jFUEče[^_ÍvUWS]CxC6 CC6 C CD6 C@CL6 CHCd6 C`Ct6 CpC6 CC 6 CC(6 C$C06 C,C4C<6 C8=u 6 j5hc jXTCT0ҋ=щH؉CPC\6 CXCl6 Chǃ6 ǃ1e[_ÍvUS] =wjuht jS3h6 h jS ssh jSs sh jS ssh jSss h jrS s$s(h j]Ss,s0h jKS s4h6 h j4Ss8su4 }u Ph h  (U {VhVS%0H~"|/t0/DjVh je?}t*hjjSVjVh j5?$jVh j#?}u V6V^ÃSh6 h j>uC }u Ph h 'U  }tyh hP 膥h}(}t Vl PVhT h &4}uh hV" u}tVh[ h &U ؍[^_ÐUEÍvUE?<wЉÍ6UE??$XT\TxTT?Ð ttjxiÐ|Ð"Ð'ÐÍvUUƒ#K$D`|̄ ttexAÐ ttexOÐ tta ttexUÐeÐ ttexaÐ ttexoÐ ttaÍvUUƒ>3$HHHHHHHHHHHHHHHHHHHHHHHHHH ( HHHHHHHHHHHHHHHHHHHHHHHHHHHHH080@aÐ?ÐcÐeÐuÐ"ÐÍvUUƒ>3$lhhpxxxaÐcÐeÐiÐoÐuÐÍvUUƒ#$LT\dlt\|?ÐcÐeÐuÐaÐoÐiÐÍvUUTuAu ttExOÐu ttexoP ÐUUƒ"$ȉ                             ؉ ttExAÐOÐ tta ttexaÐoÐ ttaÍvUUƒ"$0Ċ̊Ԋ܊AÐCÐOÐaÐcÐoÐÍvUUƒ"$ċċċċċċċċċċċċċċċċċċċċċċċċċċċċċ!ÐNÐ?ÐnÐcÐÍvUUƒ>$$4PXtEÐ ttexAÐ ttexOÐ tta ttexUÐeÐ ttexaÐ ttexoÐ tta ttexuÐÍvUUƒ݃[$|PXP`PheÐcÐiÐ ttexaÐ ttexoÐ ttexuÐÍvUUƒ>K$ܐ$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ AÐEÐOÐUÐaÐeÐoÐuÐ"ÐÍvUUTuAu ttExOÐu ttexoUUQP$6t|||t||| |||||||||||||||||||||||||||||||t|tt|||||||||||||||||||||||H||||||ttfÐ<Ð>Ð`Ð^ÐTu ttExOáTu ttexoø?Ð'ÐUEЁtGt-t-Svt8 t&<t,26LÐfÐSÐsÐ-Ð*Ð% ÍvUE<#t %ÍvÐUE\tDtDJ6ÐÐÐÐÐÐÐÐÐ%l:ÍvUE l;ÐUE l;ÐUEl:ÐUEl;'ÐUUʡ<DHt <ÍvUEЁtw-tUtC6tDtDr6tP t>\tDtDJ6ÐÐÐÐÐÐÐÐÐ%"l;ÍvUE l;ÐUE l;ÐUEЁt# t'vt6ÐÐÐ%l;ÍvUE'l;ÐUUʡ<DHt <ÍvUEЁtc!tI t7utC$ĢȣУأÐÐÐÐÐÐÐÐÍvUU\X$(6ܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥܥĥܥܥܥܥܥܥܥܥܥܥܥܥ̥ܥܥܥܥܥԥ$Ð~Ð@Ð[Ð\Ð]Ð`Ð{Ð|Ð}Ðl<UUƒ܃Z$pxÐÐÐÐÐÐÐÐÐÐÍvUEЁt t ÐÐ% l;ÍvUEЁt t ÐÐ%l; ÍvUE$w<_v %Ív%ÐUE(UE)UE*UE+UE,UE2UUTu 2Ð?wÐUE-UE.UE0UE/UE1UE3Í6UUTuЃ3Ív?wÐUUTu-2Í6?wÐUUTu.2Í6?wÐUUTu/2Í6?wÐUE?<_wЉÍ6UUTu12Í6?wÐUEP%P%ÐUUTt ЃÍ6Ѓ3Í6UUTt ЃÍ6P3(ÐUUTt ЃÍ6P)ÐUUTt ЃÍ6P*ÐUUTt ЃÍ6P,ÐUU`u ?Í6<vÍv%ÐUEP%P%ÐUEЁt+ t7vtt"6aÐoÐÐÐUEP%P%ÐUElAUM?<vщÍ6UEl=UEP%P(%ÐUEP%P %ÐUE@UU<vÐ%ÐUEP%P%ÐUUwÀttS<v?ÍvUUw`$ccccccccccccccccÐ?ÐUEP'%P%ÐUEP%P%ÐUE?<wЉÍ6UEp~)19}#6P׃} vC9|1e[^_ÐUWVSM11=uR|hQ˃C߃]vu o6hQ1Yv =u"h5ƿQhh!ƿ~119}PU ҃|C9|=1e[^_U1ÍvU1ÐU S]=\=t vӉv UӉE} E vEOMM@E}~M}~ EEEUʀMɀ Q_>A=\=tvӉ…=B߃]wyt t2uрɀ TʀӉ…_рɀ uuӉ…$u:Ӊ…@t BK6(u;Ӊ…Bt J vӉ…eAK Ӊ‹]ÍvUEЁt3 t7vtt"6ÐÐÐÐ%l:Í6UEÍvUUw\$\ȷзط?ÐSÐsÐZÐOÐoÐYÐP%UUw\$8ĸ̸Ըܸ?ÐSÐsÐZÐzÐOÐoÐYÐP%UUw\$ȹȹȹȹȹȹȹȹȹȹȹȹȹȹȹȹȹȹȹ?ÐÐÐÐÐOÐoÐYÐP[%UEv:LdMdCv:LdMdKjIZ}4\6O:LdMdGjI*-\d=tu=u u \5h h j:D@d  T8d55MdPX|1Md$=Ld u5Xd5Td5Pd[ }5\UA2v~\dj'D=Ld=\d5Xd5Td5Pdy[ 5,MlPP$$=t =jjU@=$= 5Xh \=t=u h -1=tu=u u h 06jj?FL=$2= %5Xh =u =t=u h |0vjjG?=$= 5Xh N6=u L=t=u h /=tu=u u h /6jj>=$= 5Xh 6=t =|jj=>=$= 5Xh D=t =(jj=$}Ph h' E/=$uCjh hE jH=$)= 5Xhc v5$h hp jK\df6=t =pjj1=$}Ph h .=$uCjh h j=$q= d5Xhc v5$h h jI$KXjh5,ضj轳j足X8=t=u =t%=u=th jjjP5Xj0 =$~= tjh' h jI=t<u=u <u h+  6'>h7=t3=t%=u=th jjjjjh h8 jjO=t CvI"6=$~= tjhU h jHjo ha  =$~#= t5Xhq h jsH=t$u=u $u h 6XXtSP\WƄ+V{XXPLWƄ.XtSP\Ƅ+$VX=XWL|Ƅ. =t=u PSaPV aSuVhq A ==l 蘾 D@d  T8d 2=t=u hT r<==3oJD@d  T8d=t0u=u 0u h 6X@$1҅t u$u9=tu=u u hq 6=$th 56XP5$h W6=$~#= t5Xh h j==t8u=u 8u h 6XP5<:h v=$~#= t5Xh1 h j;=XHQ =tDu=u Du h> b0d0T4d0TXX0HhJz\uX;\C6Ku0H~*|)u#XX@\X@fvX@\X@vX@(Xh)XhD\6X@\X@vX@(Xh)XhDSu X@$Gu X@mDžhDžl0ThPlPS }d h~T P6h0T莗~5\16h0Tt\d|hs 6Suw=t@u=u @u h RXP҃XBRXP4%h 5l6h 6=$~= tjhe h jo:=tV=u @hW 6h 6=  h' j貌6=t0d0T4d0T $=t5=t5jWh85}$6h8$=$j=u =u 6HP5,蛙 } h c6=,t4,8t*=th jGvh .-= t%=thO& jJ=<=/ 65(T=u h0軹u 5r=lu h0ӹu,=u#]SjZh0_ 0tR6h0ړ=,Tt U,v5\5.h8 y54Yh 32f=@ =0 D@d  T8djM&{$} 0h \d \djM0%5,=u$uj`Mz$$=$u/h %j:MT`1v=$CjMOz$} 0=0u =4th h \d 1=0u=4ut.=0~%=0#t=0t=0?t 0=C=Lt<=t=tjh0h j۝h0?6=xtC=t =tj5xh j蕝5xh0P6=||d=حt7Dž`@#Xd`PdPRqXd dtPd8tEPh0O~)=t =tjdh jҜd~a5膸t\d =uT(8u ( 5(j#PtA\d v5h h" jL jHJT`T8tÀ;u$,hS5Tߤ ;u0 5h h> j蝾 $ wj_zLS?$ u=t=u hX &=@d =X=h3CPh3hg j $ IvjyUt$ h z!jH=@d =X=t=t\6|[6D@d  T8d j9==w=jhY `}~E5hhi j߷=t=u=jtZff=et =mu f=u$ffff55P }0===xh| q6=o=uj=Pta~WuSjh h jԶ===h jjj .=jjjh EPǶ1ۀ=@t = @uS=su;=tHHP*vHHT=HuXa;XDžSPȖ=su$8uPSP 6SPh PW=t =jt-=5t88t~u =t6=5u-8t ~!tv1 6 0ӍC|" ؃| @Ƅ(PP=Huhs =H st vt=pv=tHH\MHH`6=tHHdHHhu 8tAHK=stRPS'jSh jijS>HH4(h q=u6Hd=x5h h jJ5 h h j3 jh h$ j=u== ==@u|5{hJ qbhc hXh| N =Tt jK=t%=5~jh  == ==vuh h h %v=su#h h h4!  v=gt$=rt=ht=jt =cuIhL! Yh O=rt=jt =hu ! 6! P X 5h h! j\Ƕ=uh=t%=u=th jjj袣 E ijlE =t4u&=u=uh Qh! G[^_Í6U WVS=tu!=u uh! a5Ddh h! jEDd tL5h h" j"DdPh h#" jDd XUjh5,y  E } =XEEGPh h7" joG<v 06@u1%v7F4G%GVh hB" j>U>jWhO" j ÃM@F vOjj jW跐Sh hZ" j謮t LtE=vjj jWDSh hi" j9 u udX}juhx" jvEjh h" j֭%h" jh h" j賭6|7]}uE U: T0}ЍX~?:{u|}tU:"u)|"u"UDBUSRh" j,v15xuh" j =xtd=t u=uI t@U:!u8BUlj5h" j蠬=lu/uu u<8أU}ujh h" jL65 Th h# j)= Tu h4# a5;D}t ~%=du5l5hW`16e[^_ÐUWS]0Ѝx=tkt5tku?@PHtkt€;tCB B;utkuw# e[_ÐUU U%ÐU0WVSUEEE0ɋ}щK]}} }1҃}uEw# }uEw# UE EP~E܃D19u ]juuv<]4;%ƒuRD;t } tED;t>vUԋE]E܉C]0ҋ]ԋE<щO9}}}F9u t]] }0@P輌EE0E؋}0ҋ}щMԍT Uԋ]\]0ЙEEE }Et@E19ug619=0~6] G9=019}EǍ09U ~zEEЋ]]E܋ ]ߋET9Uv6]ЊEBt9UwJ9Uv6ABt9UwJ9UvvEEBt9UwEH9}B G9}nM 0II< tAuhx# TE,9E~茁tmEF9uZ19u ~RvEDu7u4uh|# E,9]~,t EF9u }t u}tuԑe[^_U0WVSUDžDžDž} 16}1҃} uE w# }uEw# Ep]S0DžE9Vs4V!\}t0ҍzt,B=w"/8pktpk7Ƅ/_Si‹V4H9}E9 ]5|jjucDž0@Pňd0} 0ҋ}щT \0Й DžEt@Dž9]619=0~6 G9=019vNj9U] u ߋT9v6Bt9wJ9v6ABt9wJ9vFBt9wH9}B G9B 0II< tAhx#  ,9~}twDž9h#  vh#  DžPh# g DžDž|Dž]9}gV0tNuVu h|#  ,9~;|tDžE9|tDž9}2<t 4誌9|σt [^_Í6Uh(?kuh("ktkh( kth(kth(؄kth(„kth謄kih蒄 kt5$kk;1ÍvÐUhu5 k膇 kƀjÍ6UVSu] =jtCP5 kVHDe[^UkUVSu=ju5ju kt\kEShw# h# j֠uhw# h# j E EPEPSփ }  k6kS5k|Sh# Vh <e[^ÐUh'585kcj5kh# j6Ujjk408$<ÍvUWVS}= kuq} h# tk000k'90r5 kk kkkjj=jdkhklk,ke[^_ÐUWS=|k?~|k5|khw# h$ j=xku#h@迁xku h$ s xk|k$(D@D<D 0D4D8D0=kP?Ãt5kS:xk|k\ 0=kPÃt5kS~xk|k\$Mxk|kD(0= kP葀Ãt5 kS~xk|k\,0=kPEÃt5kS@~xk|k\00=kPÃt5kS}xk|k\4tW0=kPÃt5kS}xk|k\8t5j1e[_U5|khw# h2$ jj=|k} Ív xk|k$D(D@D <D0D4D8| tDh't 5kxk|kt مxk|kD xk|k|$tDh't$5k见xk|kt$者xk|kD$xk|k|,tDh't,5 kNxk|kt,'xk|kD,xk|k|0tDh't05kxk|kt0΄xk|kD0xk|k|4tDh't45k蜀xk|kt4uxk|kD4xk|k|8tDh't85kCxk|kt8xk|kD8 |k5|khw# h2$ j|kÍvUE8t8 u @8uU WVSEu tPh9$ yvjEPu usShw# hT$ jk } kU:{u0ЍX~DEuSt$jj ju{Phw# ha$ EP7PÃ~Shw# hu$ v}t.kE@'h@EPuMѡkE juh$ j菘uwRt jj jufzPhw# h$ uEPOÃ~)Shw# h$ j9E1Ҁ8tK6}t>u*/SQt'jj jSyPhw# h$ j1e[^_ÍvUWVSUu:u$ Mw# jEPu RSuh$ j荗 U:{u 0H|}uDEjuh$ jIt>kE@'h@EPu։à } 2vkESuh$ juH8t$jPK}h$  kEjPh% j詖u=Ktuh% ivjuh+% jouKt juh3% jOEMcuI%  t4u}%juhR% j uhc% juh% jEM؍e[^_ÐUSkkjujjuuu uk]ÍvUjujjuuu ukÐUju ujuuu uJUjujjEPuu u'ÐUjuujEPuu uULWVSEEE}tJE8uE}t50}PwEtuuu}}juh% j葔u h`k `kE jjE}w# $Eu$ju H} h%  j6E= kE8=j}u5 kh% juhw# h% jړ U $ &T&5555@,5@,@,h&h&X,3h% ^6}u} E8E8u$}tuV}4}6E:{u%0ЍH| }u D B}} tpE;tfStR=k}@'h@EP}7E Љƃ  k0HUC;uj5kh% j胒}7qDƒ:t#jRG}h% 2 6 kE}uX0҉ψщMQuEuh&  6}7urjuh$& jE$pE}7FS7h-& j蹑}$tD7EFƒt7]ƉuEmV}7h;& jnNjE0hK& jY}7ƉuV7h^& j;$S5 khm& j%Ep1҃~ uERuh|& j}$t}?th& _ t }t=puE`}u{]E<:tu}?t?u kf& f6u5 k2q{/th& 5 ktu5 ktj5 kh& j}:uC] Cn6Ejj0ҋ k߈щHE}w# v}t}| uyl =ku!u& }$t& Rh& 5 } uHy }ƒ:t!jR@}h%  k}j5 k' uEh' h' 5kpj0E= kE8 v5 k& ujh' sv*CKE$p}76ƉuVhw# h' j[~,j5kh' j@05k"l kV5kh' j p%}uI=ku,5 k& }$t& Rh&  Mvjh' },5 k& }$t& Rh& W vcE5j5kh' jH j@9}=}؍6E؋8uB9|9uEvkDAkuu5kh' j܉}kj}=jSh( 0C0t0C0u 0j5kh( jij5k >}h( 'v5j5 kh1( j(= kE8jh' 65j5khF( j5k>}$k0ЍP='wD8pktpkkDkjjh' NSh( Cj0C0t60C0u 0j5k<}hS( v5j5 khm( j= kE8}$tBk0ЍP='wD8pktpkkD5j5kh( j|kjSh' AS;j5k<$}h( }$t*5k[<u5kh%' $j= kE8}up6}?uT( }$t( RIE0҉щM))jE0uh( C} };t{SthkE@'h@}WE0} ׉E }}tu p5k0щH/C;u}77ƒ:t!jRi:}h( 6 k}5jPh( j胅j*CKj7h) jcE$p 7Ɖupu|=ktK5 kh) 5k5kh) h <h}tun5 k& }$t& Rh&  T6}(5 k& }$t& Rh& s (6h) bu$jhw# hw# V}}tu`nA5k5kh) h <gj'E= kE8e[^_UWVSjj1Uw# u h`k_5`k$ujVk8}vj&à kU6=jW5 khK) j{Shw# hY) ji C $6v6O8O8O8O877776678h% ujV7 kU}t_kE@'h@EP2U҃ } 26j5kS7} ha) 6 kUU8ujV$7|fU8uSU2hq) jLuP>tKVh'  Vz6$jjV6}h8) v61pjh' NvU:uh) uh( 5k5kh) zh <8ejf$Ãe[^_UWVSu h`k5`k5$hw# h) jEjj=$uM4EM0ҋ}҉H,M 0E8M 4,vjhw# h) jŀEw# , k:$tP1ji#Ë 4E5jQh) jmu 9} vtuhw# h) j3,j,P5 kh) j Shw# h) j S t$94:\:h<h<h<h<N;h<N;N;l:x:X;<S97h) m7vh% V,=,uM1}kE@'jM1h) j+h@EPM1EЉÃ} k0։HjM5jRh* j~E0փ~v< u N5k;v=,u7>t\Vh' K$jV2j  k0ЍXjSVRtjh' 6Sh' SE2$jj5kh* j}dE8uh%* uh( 5k5kh) fh <$avSh2* I6j9 Ã#ve[^_Ujuhw# uuu uBUjuhw# uuu u"Ujuhw# uuu uUWVSE}u h^* H 0}HEjEjM Mu hw# hv* j{|5$hw# h* jd| 5khw# h* jJ|Dk$uju0}#h8)  6} %PÃu hw# h* j{5$hw# h* j{ Shw# h* j{5jhw# h* j{ :6 jMu5 kh* j{C / $t>>>HHH>??????AG?9~} %PÃgv 6$1 vh% $ 5ju*1uPu]/ƃ} h8) 6u=ju }kE@'h@EP5 kMу  j5kh* j1zj5 khDk3`1uP5k.ƃ} h* q}to k8/t8M tjh' 5 kh+ $}t'19}! k<:t<=u kB9|ߍEPu 5 ku4ǃtwtC6$M jh' 5 kh&+ }t(19U~ kM 8B9U}u:M tjh' 5 khD+ $6=$t }P$jE@Mt4t ,ku jE@MDjR5jhw# h]+ jx=jM9teQh' u:,ju,} h8) Ov$j5j5 khj+ jw+vjhw# hy+ jwE P`v}tRkE@'h@EP5 kMу  j5k+} h* vEPu 5 ku1W5 kh+ jv u5 kh+ jv}M 9M'9M}%U E@MDtu EM 9M|u5 kh+ jpvu 5 kh+ j[vuF 9u vVvM4h+ j+vj5jM45 kx u\MDuHDtE t;vM4E@4uySE@M4h+ ju9}F9u gWE@M4h+ ju'tx9=j}pE@MjP5 k9Z k kjPh( " kjP5kZ+jE=jujh' vu/M jh' 5 kh+ 6E@Mthw# h, jtjE@Mtjt;M u3Kjh' N5 khD+ >*]mvjE@MttO]D[4E@MT19Tu'jt1ujMt1tC9] E@Mj}t'jttSh, k:Sh' yk jE@MtSt ,kE@MDjS'}tKjE@Mt t0 00:0008jj$j5kh", jrv}tZkE@'h@EP5 kMу jj5k<'}h0, WEPu 5 ku,ǃu5M tjh' hM, $6vM9uha, uhy, E Pjhw# hw# 5 ku u}~=0t h,  k8u;}uMPh, lv}~uPh, K 5k5kh) 2h <TvSh, $?jS5 kh- j qdPSh7+ jp:e[^_ÐUU:t kv8tB:u1:tUWVSEEEE|- E|- juh- jtp}uEw# E6EE8 t0}Ѝpu!yEjuh- jp~jhw# h- 6u]SP]Eԋ<DBEDBEDBEDBEDBEDBuEDBfEDBW}u)h- u$Tuhk7Pjuh- E@ <DBE@ DBtuE@ DBtgE@ DBtYE@DBtKE@DBt=Ex :u4x:u.x t x-tx_uuhkOjuh- juh- jnu EEE@EE@EE@EEEEE@EE@EEEEE@EE@EE]v1ۋut>6> t>-t <v>_u)F>tr> u vF> t>t_tZCtI>:t>Pt>pt >At>au/<DBt FDBtE vF>n9us uE}EP}ujhw# h. E8ujhw# h/. vjuEPS } uE0EEEEEEẺEEu6tjhw# hE. R6uP"ujhw# hV. 0u0"uDjj uhk'E}jhw# hg. uhx. ]ST] ]0҉߈u]]}`]0҉߈]}t ]jj juMjj juMƒ ~  ]EEQ # ~uB!6]EE(jhw# h}. vjhw# h. vjj juFMPhx. EPS juh. j,kjVh. jk jj jSME~jhw# h. 6>u3} u-uuuh. hk!STE11ҹ|- >tLE|- E|- >>:t>Pt>pt>At >aPVh. j^j>Pt>pu!~Mt ~m~o6>At>au"~Mt ~m~2vF>t&> u6F> t>ttCtF>IShw# h/ jijuh/ ji juh*/ jijuh@/ ji u&u~u EEuuEEjj jV!KÃ}t  } t}jhw# hV/ 6jj juJǃ;~jhw# hg/ n6jj juJƃ;~jhw# hx/ F6|G|C} tJ~B~=jhw# h/ vjVh- jjhw# h. j]hvjuh/ j?hjuh/ j.h ujh/ jhSjh/ j h Wjh/ jgVjh/ jg VWSuuuh/ hk P =tLShw# h0 jgWhw# h0 jg Vhw# h$0 jgjhkh50 jtg1p[^_ÍvUu u| kÍvF0 ÐUWVSU}uuw# :uY0 w# jEPu Rjuhj0 jf]SEEjPhs0 jf$t`kE@'h@EPuփ } d6j5k;}}u8h|0 P,6kEju}}u Sh0 " vke[^_Í6UVSu=@ktV=4ktM19$k~+@k<t4O@kC9$k5@kO@k5$k8k}6|-4Pkh6F:4oh;F)61e[^ÍvUWVSEE5LEPh25 hCF2E8u E?uFtuFu EEvE8-uE}u10}H~hFb}t!EEEuu E!P~&=~= ~, 0h)F1ۿ}t@v8t1Ph+FŧG,9~1C}uÃ}thF菧}9]2hLc."hchchdh&ehehhf5Lh25 hf54hS v6{6hfvjhwgfZhgVJhwj:hg6*hZh&hh hih$ih5ihih=jhph]jhjhp}hqqo|h0=kk9kw'68 uH9kv8 t H9kv@8 tPhZs1e[_U|uh kG1ÍvÍ6UWVSA~&=~= ~, 0h)FE1ۃu8t{vu4h+FĘ0#hTxRhhOhz"hh!hhhh}hhnshchSh}Ch|}r3hTb#hԉRhBh2hn"hxh5thg(=|u'5th h hhh0h)FדZ6h$Khxz;hnj+hTZht& hx:hhEh4h̍hhhth({hkh|[hfKhpz;hj+hXZh& ho:h8hh#hhh|ohh4~h<rh~fhfrZhfNhyZBh5N6hB*h6hN5kh_x1]ÐUS]u huZhPhZ 6}T F h)F!X $6dԑ (D`|$@\x̓ <XttԔ,Hdԕ (`D|Ж P8Pd25 u2Ph4莏uPuPhc jvhLNhiDKvh2h(/vhh vhEhwvhގhԎvhŽh6踎vhq覎h蜎vh芎ho耎vhnhdkvhRh,HOvhh6h,3vhhvrulPhkuPhhƍh%輍vhX認h蠍vh莍h脍vhrh#hovhzVhLSvh:h07vh[hyvhh vhMhj܌vhʌhvh讌hn褌vh蒌hM舌vhvhlsvhZh8PWv+uPh.07 ,u$Ph*h-uPhhmދhԋh6h辋hU贋vh袋h蘋vh膋h|vh)jhE`gvhNhDKvh2h$(/vhh vhh1vhvފhԊvhŠhd踊vh覊h蜊vh 芊h<耊vhonhdkvhbRhHOvhz6h$,3vhhvhkhvhhQ؉hoΉhhM躉hQ谉h覉hh#蒉hS舉h~hth.h8 bh[ Xh NhDh :A6h &hL h h &vh> ho h h h Έh> Ĉh ~h 貈h 計h bh 薈h7 茈vh zhl pz6h bh vhDNhnDh: Dh*h *6hhI65khZh)F1]US]uh}O$$vؙ(8DP\htșh+hh hhOhzhojhZhXJh:h-*h~hRrh&fhZh?NhBh6h1*h读|5kh]ÐU(WVS}u" Dž4Dž X}u"5Dž,Dž /}t TDžDžDžv}tZDžPVh #?5LSjPVh=h#贈(0Dž5LPh=hP#袈 J‰j19~R9~<t 49~vC9}u 5 }u }u 519~/6tDŽC9Ӌth_#衃cv}u&uhw#lɍ65`Zh(2ƒ t$ztR0H~0ۋ׈I~\ Vh#j0ҋщFV‹uOh#譂1ۃ9tDŽC96hVh#j`}uz5h=h#j@=~W df| t;8\ t5L ffVh#jF9&Ph#w1ۃ96tzDŽC96[^_ÐUpWEEE5LEPh=h$9U0H uEP5LEPh=h辕U0H NuEP5LEPh=h&$ltPU0H ~j Rh $hvuEP 蟵|MEPhEPhEPh~=%}Í6U=t`=t = Ë u/t=  u uÍ6USE5Lhh=5 hÃ|Hu"5LEPj h.$h0$I~|!q|SwxPET]UWVS]=(k(khh4XvS"v15w6juvjh=h=5 h-Ã}0u1u hN$-~5Sw 6譳Å|h4u=(ke[^_ÐUW5Lh=h=5Th襙ǃ5 k5|YBǃj|Y0HPhU"RduU=t ==ti$Phn$F}=t=u h$(}+3j|Y0HPh* Rup=t/=u =Ht i$6=Ph$|'6=u =Ht=u h$|+vEP5T5|Yh&WE@4h$jj =t*=ti$PE@4h$|&6t =uE@4h${)}ÍvU5LEPh=u g|(u4ZEPuLÍvÍ6US]Sh=h$j5h=h%jv u/Sh=h%jDt]  4    C8 6=~Ph(%z=sh *s$h s(h s,h  sThP sXhT sLhX sPh\  sE>5hU+h E= 5 uHhw+Fj 8+u h+/j= t 5 @ 5 x=, uhxh, =$ uh+h$ f=Ȳj‰tv+Ȳj‰tS+Ȳje‰t0+ȲjB‰t +Ȳ=H ughxhH V=, uj‰, t f.$f=$ u%j‰$ tf+f+B5 + h+h$ h+h( h,h, uh+,h0 ahH,h4 Mh],h8 9jEPh=hr,EU:`ZE:\Rڡ<DXt0=ftjjjh,utRjj h,utt:jjh,u\t"E(EPEPu!`ZE uh< h,h@ Eh,hD 1h6DžH6HuN-&u-6-&uv-5LEPh=R{E|T}tN0}ҍB~6RHD̃t uP|HHb}&u =Ȳ v=śEE19}(&u j j̲PC9|ك&uH Ȳ6H 19H~36&ut̍ 6t̲̍PCC9HE19H6|t tC9Hvh-hH iE5Lhh=5 hƃt.5Lhh=5`hH€EoEo}~E55v5Lhh=jhtlƃ*E5165LEPh=h-cyE|D}t>0}ҍB~&R%Lt uPF~}uw莙E19p~.<t4C9pӉ5p19%vLC9p19} 6LtLC9|E6hXh X5LEPj h=h.ybh'Vuh Xv5LEPh=hA.wE} usE}t,E8u E6u5|Y|YE*E|.uh &hp.^b<[^_Í6U(WVS5h=h.jPLcPh=h.j7 5 h=h.j=Lcs=u = ]jhLch.jhLc*EjlP]S S EWcZcjj jhUcÃjj jhXcxƃjj jh[cc[CvWc:Zc:EEEjj jP ƃEjj jP ǃEjj jPvF4΋U+U܍))ڍ4Vh=h.j~TVjSh.jhh.hLc hShLcjhLch.j]=thLcj 9q5 h=h.j+= t~jjjhLch/^5$hLch/j$Sh/h*/j=$u-~)jh^ch;/jh=h^chK/jaLce[^_Í6UWVS=uhV/M_=Lcuhi/5_jhLcuVXEhh^cj@Pj S襛(V`8jP]S SC4EEEjj jPÃEjj jPƃEjj jP[CvE:E:EEEjj jPbƃEjj jPNǃEjj jP:0vF 04+8))ڍ 1~ Qƃhx/]EPhz/]Dh/]Hh/]@@$dv            @Ph/^6@Ph/J6@Ph/66@Ph/"6@Ph/6@h0\C@u0Ph!0w\$[^_UWVShVhLc0ۿLcщHEщM8ҿE)ȍTE =0uLchh8Phh50V36hP0V!jhLchh0je[^_ÍvU WVSEr0'.hVhLc0LcHEH wEv00ۿҿ8щM)ʋ}E)ȍTUU4uLch8huPhhz0V$vh0VjhLch0je[^_ÍvUVSz[hx/dZ=~4/61 L uPh0(Zh0Z =Pu h0(v=Puh0=Puh0h0Yh0Y uu h 1t h1Yt h1Yt h1}Yt h 1kYt h$1YY t h(1GY@t h.15Y} h41$Yt h81Yh<1Y  ~ShW1X6h`1X= tPhk1X= tPh1X= tPh1oX1= t1Ph1NXh1DX = uh2/= uh 2= uh2=  u h0WX= tePh2W5 RPh:2W= t =  PhW2W= tPht2sW uF8Ph2WWӡ<DP@tRh2:Wh2-W*= t Ph2 W uFP*= t Ph3V uF$Pє=tC,9~1۸*= t Ph+3qV uF(PlC,9~1۸*= t PhF3V uF,PC,9~E=1۸*=P t Pha3U=P u jh|3j5P h3jP uFTP蟓C,9~1۸*=T t Ph3RUT uFXPMC,9~xp1۸*=X t Ph3UX uFLPC,9~&1۸*=\ t Ph3T\ uFPP詒C,9~1۸*=d t Ph3\T` uF\PWC,9~z1۸*=d t Ph3 Td uF`PC,9~0(1۸*= t Ph4S uFlP賑C,9~1۸*= t Ph.4fS uFpPaC,9~1۸*= t PhI4S uFtPC,9~:21۸*= t Phd4R uFxP轐C,9~1۸*= t Ph4pR uF|PkC,9~1۸*=h t Ph4Rh uF|}-CvE4t|Cuu?4B5LEPj h<<hA<=|Bs|Bu}5Bv5LEPj h<<hY<m=|zBs|gB|~!ht<=h<=h<,Bvut6(B6hH5*3BC>$D@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@4@@@(@@@4@@@$@@@@@@@@@@@5E5jjj,׀E },5h=h<jbE5}~=t5h=h<j"E|@6jjSb|Ph=h=j5h=h=j,|+@=@-@@65Lhh=5hDWE?p|?19~"9Et B99h&=;k?Tu>5Lh=h=jhVE\?mpEL?Edk+?h s165LEPj h=h>=9E}lhO=`:]v}}" k8-u hf=>6h=>6}O h=>uh=]S臻5LEPj Sh=`9E p>}} k8-u hf=E>h=;>6}O h=)>KoE*>uuYE>5505E 9t5505E9<<v5Lhth=jhT|}=nEm=|H<|u`ZB`Z@|h=5`Z h=5`Zh=)6K=6C j1]Sh<5Lj5h=h=h=jEPBo(jh5Lj5 h=h=h=jSo(EPOo|Ph=h=j|O<=,lb/1҃:t=ut 8l <4lEPh=h+>j}E$T6<<< <$4,16661'yq%i&a/Y.Q#IA91)!uh:>s6:`F/<$p0\\\\\\\05LtB0v!vwVRBv` vF5vD0vvw VRB` vF56t=0v vw VRB6` vF5:60vvw VRB` vF5R>PhZ>5xh=P|8iE8td0vvw VRB` vF|50vVRB0vvw VRB` vF|50vvw VRB` vF|5LuB0v!vwVRBv` vF5vD0vvw VRB` vF56u=0v vw VRB6` vF5:60vvw VRB` vF5R>Pho>5xhN|6gE6tx0vvw VRB` vF|50vvw VRB` vF|0vvw VRB` vF|50vvw VRB` vF|5465LtB0v!vwVRBv` vF5vD0vvw VRB` vF56t=0v vw VRB6` vF5:60vvw VRB` vF5R>Po>tZ>P5xhK|X45Lu@0vvw VRB` vF5vD0vvw VRB` vF56u=0v vw VRB6` vF5:60vvw VRB` vF5R>Po>uZ>P5xh{JE3(dE30v vw VRB6` vF|50vvw VRB` vF|50vvw VRB` vFE50vVRB0vvw VRB` vF|50vvw VRB` vF|50vvw VRB` vFE50v!vwVRBv` vFE5!05Lh=h>58hhHE1}S*E$T6l8h5Lhh>5ԺhG|0aEq0|8O/vh"65LEPh=h>_CE+0=p8t5p8蹮p8}tE8up8.v0}PUp8D/5Lh!h=5@hF|/|uR5Lh!h=5hDF|S/d`EC/|8!.|u15Lhh=5hD_F|. `E.|8-65Lh h=5xh F|._E.|5555`-5Lh>h>5xhE|A.5Lh>h>5xhwEE.$_E.U?|???,v5Lh>h75xhE|-5Lh>h>5xhDE{-^Ek-||<E}<~<<3,v5Lh h=jh||D|-5Lhh=jhODE,]E,|t|t+6E8+vE8+v5Lh>h75xhC|q,5Lh>h>5xhCEC,T]E3,|\=E]=^=_=*v5Lh=h=5h@C|+|w)\E+|c%8*|Ej|5LEPh=h>>E} ud 6u|0}H?~ h?)+|*|$$6@|Thuh臠)6uhNs)6uhM_)6uhMK)6uht57)6uhLE#z)6h/?%i)5LEPh=hF?=ES*E8uEuhx8] )5Lhh=jhlAE*[E)E8(6 'tv765LEPj h.$hV?$|)Z|)}} hf? uh=h?jh'ju Pp [Ptv5Lh=h=5Ȼh\T@E(} ?"E$h6(|L\5L|Pj h?h?n#E~(|vh?#:(voYEN(|uj$'|'j'5L|Pj hQ'h?"E'XE'|EV'vhH6h6EPo|'uxEح1҅t$L\&5L|Pj h?h@2"EhP|h02'5L|Pj h!@h$@!EhP|h,M&h&h&O t$v4jld&65Lh=h=5hd=Et&}uHjh=h@@jh|Ph=hL@j׺|&&%7W|&uh=h@@j蝺Et> tBvtS56=$j$jhX@G%%vm$5L|Pj hb@hd@B E|} Dž|hu|hdtKtP6@ 0tvE6j赬$裨$65Lhh=jh h6 TPv5%5Lhh=jhPp3E }[hK6!u#z‰|%C$ D \\\  \\\\ \\\\\\\\\\\ VS%R5LhhA5h\2|!2LE|v|YqhhAP֗5Lh=5|Y552| }h%vKE=uhAK=thA3|uFuK|} ShB_9tPh-Bv=="uhhMBC6=uhh^B!5hhmBv65LhS h=tPtP0EB} E$ < D p(85Lh=h=jh@0E}u IE5L|Pj hthzBzE|~|t hB]5LEPj hvhB5EE} hB$vCIE"|E65LhCh=5hH4/EH|th=E@4xh"Cv}%DEH=dbY|S E߃v Ew'}uM l 6Ej 6hG 6  5L|Pj h.$h HE }55 kƃ} h:H MxxPx jj jPÃxjj jPǃxjj jP˂t[Ct9}ƀQ)ƃ|} hhH 6=E ~||ַ  65Lh=hEjhܭ"E <|} u?^ 65LhhHjh0"ED \|}u jZ\jEPh=h:E}|-\v|\0}H?~ h? uEEt vt 6huh 6huh$6C$ $|$$$<$$$$H$$$$$$@ $!l!$$!$" #"D$$$$5Lh{h=jhغ!E :| }%a5LEPh=hH|t } B E=L:|( uhTA=T% 6==u =hH?Ã=ؐuhI'ؐu=t*5LSjEPEPRhI|%v5LEPEPRh!I_||} |4}u5|Y}jEPh=hVI3|h(u5`Z蛂8E |Y8t*hؐhPTj5`Zhؔ\vؐؔ}hH}XXgu =4=u =tC5LPjEPEP=guPI[urIP1|365LEPEPh=I[uIP||} |}th?I!vu5|Y|jEPh=J[uIP|[h(u5`ZY7E 5|Y8tVhPyRj5`ZWbv5Lhh=jh$<|6E|Pv5Lhh=jh$|6Eu|lSv5Lhh=jh`|5|u~jEPh'Jh)J=E uE8tXxt h9JU< v<v<w hWJvEv5E||5Lhh=jh$|ar5EQ|\/v5LhBh=5hpt| |t tRvh$h(5Lh h=jh |hi5Lh=h=5(h|i|t txv5Lh=h=5Ph,|!|Q%4E|~ \%\5LEPh=hJ|uhј5Lh=hJjh|y3Ei|H|7vh75Lh<8hJ5dhl|5 k5|Yw|YE2E|4h5|YSw|YE<UЉEZ<DXt 0=BE@<UBУ}u'1zntB(U1zntB5Lh=hJ5h4||t &t666h^5L|Pj h.$hJREhQP|hUvh,TFW1||15khKy6h>|h[^_ÍvUWVSE=u#5h=h$Kj`=u 6uh=h0Kj45h=h8Kj 5h=hFKj58h=hTKj =t =u}=1ۃ=tUd|=8u1ۅcKthheKW6hKBN=Pu1v3|à =8u1ۅthhKu}uJ=uA=t8L}tLP {EPh=hLj̒}}EEe[^_USiPh.Lz1ۃ]PCP]PShpLSuPhL9 hL*]PP]PPhpLuPhLhx/CUhx/]Í6UVS1hL1ۃ6]xtFShLC~ޅu h 1p1hLa1ۃ]xtFShLFC~ޅu h 1,hLe[^UWVS=TT(5p=4u#hs4u hRe4RRP=$u6=$B8-P{DžPVhS{j;rh S5kfxj5khSj,hS5kt5LSjPVhPhPS$}5Xj;{Fthxh:G B8=jPh!Sj20S1t FO)ȃ|8-X@MShPh3Sj׎CՃO $ +`,".`,".".".".".".".".".,".".".".".".".".".,".".".".".".".".".".".,".".".".\-l-".".".".".|-".".".".".".".".".".-".".".|-".".".".".".".".".".".".".".".--.j} h?Sfb6vt8o\Uvzt hWSa~ 8-u hqSa0:H?~ hSa6hm@=jhS{sPf hSa254lj54hSjЋ vdt$[^_ÐUÐUSMU I|t R|u 16R<u I|t R|umI|t R|uMt#ttt+t+t ,t,uAڃvBڃw]Í6UWVS1=t=t =5t=u=t8t u}~ M ,5hPhSj)=@t~|ujjPue=5u\= uFhShShCThfThThThTy 1tL=@tC=t'=@uj%c=u=@t jw4^ƀ=@tm= @td=5u[= uR|IhShShCThfThThThT 5hPhUj覈=t"=l8t@}5Xj=4t}5Xj݆P h hȓ ͇5hPh#Uj5hPh6Uj,5LhPhGUj=5hPhYUj5hlU5ruJj5JhzUj莇[@D P5JhlUݾhlUw 6jhPhUjE=;=Ѓ=L%5hPhUj u}~ M t.=@t%=@u=t=u j1 \Ɖ 5hPhUj聆=t+$}"=l8u =4t`5Xjф})P=4t.5Xj蟄~=0=Ph hȓ rq@d e[^_ÐUS }  6601195~"0R9Lu|tB95U]Í6U0WVS]M MEEEEE=t =lt+=t Sj !ShUKSju ShU3E5T5EPh×}hh Vy16}t=t1=tPRo655R }h!V116E=t=t =5t=u=t8tE5`5Ptƒ=P9`uMEEEE~h7Vh>VhVfEvBEЋ `‹MM PEЋlGM܋ME؋lGUԋ TMT1h`.jhEE6=; xxtEtE}~ !M=.}3EPn%P}u}t h=t5==tE"j%Pvƅ|K19v5E~6=teE"j%P)}u1SVhPXjwj>|u_^jShWXjew~t ; uC;ujSh`XjBwSj5hPhlXjw(}tdDHLPX\`dhhDvjjVj\=~VhL_|W 6L_e[^ÐUVSu }uEPE8u1DVuhzXjPhPhXjcu(=u EE8|t~tdlptxhljPjjuj==huhMgZ =tI=tj5hXjqQ=t =tjhP5 jHQUR=t#=tjhPujQMge[^ÐUVSu] uP>u1SVhXjsj>|u[^jShXjs~t ; uC;ujShXjsSjJPhPhXjos(~6tdhvjjVj=~VhHOS 6HOe[^ÐUVSuuP>u1j>|u]^jShXjr~t 6; uC;ujShXjZrSjPhPhYj;r(~6} tbhjjVjx=VhHSRj5hYjqjhP5 jxq(=(ttjh(hYjYq=jtjhjh*Yj:qjhh8Yj$qjhhFYjq jh0hTYjpEPujhPujpHSe[^ÐUVSu] uP>u1SVhbYjpj>|u[^jShiYjep~t ; uC;ujShrYjBpSj PhPh~Yj#p(~6tdhvjjVj `=~VhHGP 6HGe[^ÐUShY?=t+P=PuYPhhY =u =uP=Pu YYPhhYhY=t 腨} hY'6="uhY=uhY~PhYm=t hY6hZN=t h!OvhZ.=u}PhZ6=u h!Z=u h!Z=u0=5u h*Zv=5uh7ZhFZ= u hOZ= u hqZz=u hZd=5u hZNhZA=t=t=u  6Pk<ÃSP=tZPhZ ==]ӡ<DPt <U%=nhZvShZq=t SEPhZ=tSEPhZ? 6ShZ-h[vh[[=t [Ph[h"[ = uh)[m= uh.[]=uh3[M=uhU==u<[=uD[=uL[=tUPf5hS[PhV[C=t5hd['6hh[=Pu n[&v=Pur[Y=Pu.[Shu[=Pu+=Tt5Th[ h[5Ph[ =tc=u$=t=thh[O=t-=u$=t=thh[hZ =tN=tu=uPh[4@%P5h\]ÐUWVSuh!\h,\h8\hC\hO\h]\,9~Bu v11ۿ5v/$P@Q@Q%U@Q%U%U%U%U%U%U%U%U%U%U%U%U%U%U%U%U%U%U%U@Q@Q%U%U%U%U%U%U@Q%U%U%U@Q%U@Q@Q@Q%U%U%U%U%U%U@Q@Q0vvw SRB` [C|w@0vvw SRB` [CD6x\P0v!vwSRBv` [C|w@0vvw SRB` [CD6x\P0v vw.60vvw 4 x\Ph\00v vw SRB6` [C|w@0vvw SRB` [CD6x\P0v!vwSRBv` [C5wF0v!vwSRBv` [C56vx\Ph\F, 9~W?1=t80vvw SRB` [C\|t\P0v vw SRB6` [C\|t\PhPhP6hPhP0v!vwSRBv` [C\|t\P0v vw SRB6` [C\|t\PhPh\F,9~=41C>e[^_US]Z=8t!OPh\[8tt 86tt*h\h]h]h]h]C,9~L=1h]@tt2tt%h(]h7]hF]hU]@t t4vtt%hd]ht]h]h]Z=@t&]= @t]Ph]0vh]=@t&]=@t]Ph]vh]hZC,9~<H1h]8t t!9vtt*h\h]h]h]h]aC,9~;1h]85tt&th]h^h^$^=5t^P$^=5t^Ph(^C, 9~;<158Ph7^C, 9~:158PhW^_C, 9~:1hw^6=p8t5p8h]h^ CtPh^vhh[C,9~ ):te158Ph^C, 9~ 9t41ۡx8u^Ph^C,9~9u1ۉ؋]ÍvUVS=!,u^Ph^0FT6h^1ۃ9~;4,Sh^F, 9~991C9h_F,9~91=h5u=h5thh5h_6h)_vF,9~8C1=u:hZDFVƃF,9~n81h2_ F,9~E81=t:hhO_Hw*=T5t!hT5hY_ h__hk_Hw hs_=u h{_=u h_=u h_=uh_r=u+=5u h_Yv=5uh_Fh_?=uh_.=uh_= uh_= u h_F,9~61H5H5Ph`qF, 9~6>155蓾Ph`uhPhuj&> 5<hPhuj >@hPhuj= 1E 8t@h6VhuS(&M 0IQRSj=FE <uȃDtA=@t= @t jj=@t=@u@jDž\`1DŽF_~[<u81M t-<DXt 0=B:uFE u联Ĕds}%X=t==5hlU5r_ uSj5Jhuj_<[@D P5JhlUshlUH jhPhuj <}u LK=XVhPhuj;}g`t<===P@hYV @hmVEjB[j=DtyNÅtnShPhvj6;jh0vh:vj;j袙Ku`6X}VhPhBvj:}uLD@у vh=Dž@Lh 5%8P2ƒ t t!t'z6iY= @K=5>`h[v躠h1v=5u=hthvh=5t=tɉ8QDŽ=@t V詩@@hPhujI9"H@ АPHu9TTDž\ vDž\H44  49 4r44=<tH XX=t*=u H tH \\T[<u!H<DPt0=HHPhPhvj71M 9v;PhPhvj7H8 ;uC66<~*KH8;uS<)PWx tՍv<;FM t$<Dxt 0=BF>uu=4MG49r=[<uU<DPt 0=UEPhPh?wj_43PhPhvjI4 M8 3uC+v]~!KM8 3uSE)PV  tۀ<39=4>[<u}tuEe[^_UWS]E tu Av0ЃtH   볡 1e[_ÍvUWVS1E11t t;61lE1ѡ<DPt|F liѡ<DPtF~1PvlCDv.u}Eu1 6lC1}u~ ƃl11lU BUBƃlP}u ~le[^_ÍvUWVS]EuP0ЍP Lw)v Nw1ҋ=<DGtB~{t { tC EECECECEECECEECECEE1ۍEjj jPǍEjj jP}ƍEjj jPiE~+u#dut1ۋUxڃ}tuRWhQwhmvRWh]whWe[^_Í6UWVSuEuP0ЍXSVhfwj0 Lw6~NM1ۋ<3DBeC~EFEFEFEEjEPhqwjF0FEFe EFe Eej]Sh}wj0 jj jSE=n1ۍEjj jPu!dut1ShPhwj/|t1ېM9 }9L}C ~KMQhPhwjT/M+ ShPhwj:/ }t%uSuWhwhn NwTSuWhwhLjhhwj.jhrPh}ue[^_ÐUWVS]uP0Ѝx1  1 <DAtG~ESUCESUEujj jVEEESUCEEUjj jRϊCE[]EUjj jRw EE6Uҍڍ}]_\ؾNjE荼8:}ȍe[^_Í6U WVS]ڪ% ȿ:EU)Љ)ƍN}NM)ˍL ȿ Kƍ ΍ }M)˃ ȿ ɍAE)ȉEP)É]ȿ Í[E)щM}􍌿 4uuVhwh44e[^_UWVSDžplth=pd1DF~}uEPuuhwj+jE 0hwj+ }~E5hPhwj+EEP54uh.t Džp=$30}ЍHtt9 ttR\tuSA =' uhwo3h x6A='uh#xL3hAx6hXx6A='uh{x3hx6=t#19]~SU 4hxj*C9]]Kx6} <t E 8uMKyuhPhxjZ*tu.juhxj=*UU2EP2t} Mt9u*DžpE=$D2hx6u4oE8\uEE%E@EEPu(DžpE=$1hxS< w =L|]LIP*u/=L|&LE1EP&vѡ<DPtWE%&EPEPu }(DžpE=$1hyuuy~.M܃M܋Y9Ey YtnE؋E0DžpE=$0h6y&vDžpE=$0hYyhos0vE19u}vEh EԉDu%Džp=$0uhy0E EU <uEP0}ЍH];{u|}u D E;6Y~M< t< u EKMMAM9 t9 tuuhyj'EPEPuQHShPhyj&,uhPhyj&}CVhPhyj&Džp=$/}.uhy.Vthxj&F9u=t619]~/6S} 4hzjU&Sth1zjD& C9]Ӄ}tT$ȓHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHDžpE=$-uhFz,EtX,t$p,\  xt,,ԖdD ا4|pز,,tȵȵxxHȻPpXоĿĿPP|5u5rs|  @rLM1+M9tQ讹E 6EPE8+=$*DžpE=$*uhaz*uu0ЍXEP*> uvEKEԀ8 tEԉE19}EԀ8 tEF9|EԀ8 u$EEԋEԀ8 uvEԋEԀ8 t vEP}t'M9t5Q5rr| 6Dž||}-DžpE=$)uhz)6}~@u9]~*6htVhhkVC9]؋EEEP|z)[@tu|"à M)ȁ~Kj]|G|)LE(mjhPhzj hzW=1Džp} ELw(twpttpM9t@Q辫|} Dž||hS[h"E 6ELw}ju]S }\u]DžpE=$tuhzh ;&'{t{['{]'C<wC |CP菷t'DžpC4X|hS[h> =t<1ۡ8t 4C<u5jh}W|Pc 19||H6h身=t$hPC9|}tT|hS[]SVSV}1ۃ9|~&D4DPVC9|ڍURhl=htdp%vE=% <%E%6ELw}%0ۋuщNEEԉщHxB%:%)1Ƀtt}M9tQ蚳vzVt.jj jVzH}1Ƀtt)ˉI}<18Džp=$$uhazhE$v[4t%PQuuVQhS[hDE A$}6$}0ۋuщNE艅щHx}~$U쉕׈щH 6Dž+xC~ t xuuu-EEh[4xuuu2tuuU x}EԊEEEKuEEԊEEEu`6M9tQzvPVitfjj jVZƁw)EEE"6Džp=$y"uhz_"Džp=$U"uhaz;"]0HEPhS[ "v}^E0}HPhS[!6MuPME9AE<DHt 0=EԊEEEԋEԀ8uvM9tQvPuE}'0PEVPu M9t Q觯PVSjj jVujj jSdÃtt" ttTttH9}C?9~;7u,Džp=$t uh{g h EShS[B vDžp=$5 uhaz u } P}~M9t Q艮ƃ}t u0PUEVP[uP }~M9t Q4Ã}~0t Vt-tuJ}~D0t3Su&Džp=$;uhaz!6E0}HtuD}~jj jS| vDž|}~Qjj jV\C}~jj jVB|v|+|C|9EHE19|6EԊEEEF9|6MuPME9E<DHt <EԊEEEԋEԀ8uGv}z}~M9t Q1ƃV*'jj jVEPVh.{j}E0}H|PhPh?{jh'hPhP{j|EЃ ='~<Džp=$tuhf{h 5v&|19u(EE19|~(E-='EԊEEEC9|F9uDžp=$uhazh3 v}*EPu6} P}~M9t Q}ƃ}t>u!Eh'uh|PvVJjj jV7EЅE]0ɉމщH|9Eh'Sh6|E='}~ Ev u tuC|uu|U| 9UovEEF9uY|)}19u~EEF9u|uua|E Džp=$uhazhg vEuYEԃuEPEԀ8u$Džp=$)uh{uh3WvEu豍}dDžp=$uuh{vuuh{6uuh{6uh{vQhYxELw}s1ۃ}M9tQ6LwVt6jj jVÅ}10}H9 'vDžp=$uhazELwEEԀ86EԊ`[<u!`<DHt< `1ۋM9\=[X<T<6\X<u'%TDBt`8t)A9uuFPhS[hEEFEԀ8v}&1Ƀ}~Pu2u'Džp=$uhazjvjj juH}1ɉEPED}:]0H=]E; EԊ%EULEEԊEEԋULEEԀ8u= }]0H=O]E; Dž< <6U:|Eԃ|tDst 4ttЃ wt#6T¿zD~MUE$ˆEEԀ8GB 61ۃ}}~vMuLwMQ-t6jj juÅ}10}H9c%Džp=$Iuhaz/EEԀ81EԊ[<uˡ<DHt<MuP9tuP=[L<5<PL<u҉DWt 8A9u1҅UEԊEEEԀ8'61}4}~[MuLwMQu&Džp=$uhaz6jj jurƅ}1]]ԃ}}艽0щJ}䉽щH9;6MEԊ[<u<Dpt<EA=H[D<5<vHD<u#DWt 8u E6Au}!UEԊEEEԀ8}z0}Ѝp'~'E|}~EE0}HxE|t-h'uhƫu F]ԋE@[<u!@<DHt< @;v [<u<Dpt< 8@u E6C;u;M}YEE8=<[8<5<E<8<uȋDHt ]Ԁ;tU6 <8<uDBt 8uE6C;u;t E8mh'uh v}FEEEER <Dqt7}uEDqt#<6ˡ<DHt0=EEEԊEԄuLuh'u Q1Ƀ}~EEEPEÀ8tvE];uQh|hhEe}U0HPRcPh|h'+vEPu載1=uj_~r'v xxttO{}-t6uvMM9 t9 tEEEEKjEvEsDžp=$\uhf{BvƁEEԅ2.}~ M9th'uh0HEЃ 6M8tMy=vEBvEEԅ .}~ M9tE vE8XtEEԀ8u}uEEh'uh#E` v}V Lw}~M9t QɛƃV¾u'Džp=$ uhaz vjj jVEЅ}E}}0ɋ]߈щH|U)|y Dž|EvUEԊEE||Eu费u%Džp=$R uhaz8 jj juP|t>u |Qh t>f0ШKjj juoPh|h "uh'u u|u:EPu5M9t#jjjuQoM~ED}] |E}~Huȼu%Džp=$ uhaz jj juE}~|}&}t}߉|Ӊ61QhS[hE 6Dž4DžDž,Dž$PDž PtF%0t9M}'Džp=$( uhFz v0ugz}~M9t Q肘ƃV{u$Džp=$ uhaz jj jVHEjuEPNDžpE =$tuhzh_ }&^ }t}[N }]D E<wE E<* jEP蒝,E=$ uh|vEh'uhF DžpEE(}~ U쉕$}~ } 0u }XEEEPEԀ8w1R$8t!EP$K$61ɋ]Ԋ< v<v<wu' :tEPRȅt'4Dž4EԉE|64tqDž40tHMԀ9tE(Wh5|]SnuSR,9t>#69UYEPEԀ8tEԋEԀ840whS[h Zu4u%Džp=$uhazjj juJƒ<E<h'iPhBE<Ew6ju]S }\u]DžpE=$tuhzh ;&{t{[{]C<wC C<jCPS1DžpQhS[v} vEEjuؕEPPhEDžp=-gp=$Tuh>|:vuPhEDžp =-p=$uh>|} !vEEju E8|uPhYhtEq1uE8-uEu菰u4Džp=$uhazh uvjj jutQ)PhzEDžpDžpujEuEPE8Džp=$uh~|p} vEEju蘒E8-u%Džp=$:uh>| Džpu Ӄ|ؙ|EtTu RhS[|4\h3W1ۋM}LwQ:E8-uEu׮u4Džp=$uhazhW vjj jutم}3Džp=$uhzh l6ȿӉؿ<։VSQh|hEDžpEuet}TDžp=$u uh{u6u uh{du uh{Tuh{I6u訍Ph3Wh07vuhy6Džp=$tuh|h Dž|E9|}-v||t tv|}9|| pu0ۉщH|~D>t8uhyh[EщH| =(tdjhPh|j=$t3|~M9uDEuh|X]PE[^_Í6U$SEPNju܍]SZ]jSh|j4U܊BJBKBLBMN jhJh|jE@jj E܃Phktƒ }juh|j }Rh}hN Uܰ0z tBPE܊@ QR SjhJh|j\ E܊HB~[jhJh|j(J]Í6USEPM}tE8u PvE,C~U0z tBFE@ G1j4xEP tC ~ރ uE?D?+C  D0D1ع 0EH@]ÐU6p /P"CD6t  PCH6| PC6x PC65`hS[=Tt TEDh}Eu/h}Euh}EuE}huhF EF=FtvEE8u}FEx//EE65<hS[ h³PhF65hS[50hS[=<~<4d[hS[Lwr6$ f6tw65hS[zjhS[n=h5u"chh5h3WQv5hY>6=@d05lhY5hhS[0=t"i0=tFFTf}z6=ؐu!h}thPhؐ&ؐDP=ؔ2ؔ(P=XX =Xu#h}ÃthShXP=XXP=XXP=؝؝6=u P=u P8t@PhF8h}hF5hFfLwfFvLE~ %EuhS[T65hhS[6u}PP=t}Ph}hFD5hS[5dhYJ60>626&6=jt j(665phS[65hS[~}U Um$XmPhYF=t4=t+=u"PmShF vPKà ʡ<DHt<=n=tPPh~i=tPPh ~PPh~hFvh5,hFJ0FHEPF/CƀF/EƀF-6=(t9\0\H~ D]Rh~E761=$t\e[^_UWVSMEM E=d~!h$~cEEjF}t}uEj#0}HEPuhW~j'}}BEjvjEj jE0MM6\t#UEEEHEjt6EpVJFQ/%t\$ 6&6Mc6mSfvv76EEEEEHEjEEEE< w#=L|XLIKv*u'=L|LEu4EP!6ӡ<DPt ËWE}_EPEPu DjEPEPuXvVuhf~jEEv:[uEE8]uMtE@E€8u݋E8]uEuuxVhPhx~jU¡UY9EYE<sP4h~j_EPEPE4Ej6E=v}EEEvE8(t؋EtEGEE?~}?~#E :(tE@E€8uE8)uEEP袽E]ShPh~j}=t5EPZPhPh~j_=uWEj hPhI~j0} u6GEE6=]EE1ҍ6EGE8t\8{uBE8}uJE8(uEEt3<)u Mt;,u}u KLFEC땐uuh~j^j5h~jJ }uQj hPhI~j.}t u!=5v=t0E9u}$vuEth~jE9u|5VEPuH‰UtvE]vMyOj hPhI~jx}t uk=>5P$EUEEuME}t u=5v];(t%EUEEMj C'C}E;)tt CGEE?~}?~;t ;)t C;u;)uC]0}P9Ãt+MMQS3E@EPEPSnS(juh~j1$u uҸPmtMu>5u5r'‰U ~rRDEEvuE}t66Myt Wj\6EUEEuMEtjWd_vMQ蓍E}5EEEEEy0jhPhI~jB6UEEMU2*E EM EM1t[^_ÐUh蛸ru Ívr@f@16T@?~1ÍvU=u1á[@<uÐ[@<tÐÐUWVS=hu h!h辷Tu h>ȩE6EuTFu~ك=C EE| RMQ: EEU9tuuEU<^E4h]uX uE<"uaEeEUu<uhiu蚸0}эAQ臶E}~o19}~j4u8~G9}9}~D]K9|<E6[4MA UT2QED0AK9}1uu Mu4 EDUu Ⱦ ELEEEU9u5=u#h肵u hl茧E6EE}~硸44/} h@h[u hhu h̃hʹu hצh誴LVu h账h致u h!葦hd[u h>nhATu h[Khu hx(=4u#h4u hh (ϳJu h٥h (謳|Yu hτ趥h (艳`Zu h蓥1ɍ6rA_~} hhLV[T[@@<EE@E~=t ( $Q$.O*5Th%7#5Xh2'#5\h8#5`h=#$5dhF"hhhMm!M~rMfDhhS;!M~rMfDhhX !M~rMfDhh_ M~rMfDE5hfEPȶ =tvEPEPEPsh EuEPfuhn]SdEPEPS2hE ~!uEPZfp0h\ap2hvd!EE9]uhfSU5p4S(!}}KpEUUztUU|u E_6}~WE} )E\E%E0EEU5p4S }~Ep4u4\VbEE9}|UB v\Y\YERp[^_ÐUWS1ۃ=u/=t4,t6|Yq5h3hj 5 h3hj = t8u4P5qìk=t545q覬N|Y=t,55q肬q8/uhPJ545q6j5|YhjKh5|YP<d[0=|YPܭ¡<t5|YR˫h5|Y54ҰLV T T [T TT TPh3hjF [@<TDu,Nƀ-Ev54h,0,ҍB~B~v,/tHe[_ÍvUWVS]11]u h3h…j1ɃLE<tYK9M ~QU<{uG;}uO;(uF;)uN;,u~IACLtE8uU:uBjh3hޅj$_vLjShՅj C=Pt=tuh/juhj1e[^_UWVSu] =LWh3hjhSV~|ujPvh 9=L~O5Lh3hj,j5Lh3h*j$=t3 몐5Lh3h>je[^_U$WVSEEMMu uVh3hUjE @PsEu}jh3h\jrSjh3hrjUuQM(uuh/j*uhG-uvuFuuu u t}t x <d[0}ЍxWuhj}1=t5=t,u}u<d[6xPhD- MM܉9 t9 uvKE܋u܀> t> tu }1M MSh3hjE<voSuhjuèt<~89} ~3ʆu95kuPhن,GM E 6u訯6_~ u<3 wKySh3hjrMDjQh j[U $v<;t<#u9Ut z tz uJBu9Us69Uw9Us J: t: tjuhj0}ЍxE )0ۅ~u\>E~ ML9Mu9uuD}u>=t06M8uz t IM܊u9s NuB:uҋUMBAMtvM uBFuuM}MPh3hljPh3h~j EPh3hj}~ u܀>}uM}u -t{uj-t{u}\tZ{uE -u ME vMM,AMM uh3hjxjh3hje ]}tu }u MuFuMuX)juhÇju1e[^_ÐUWVSE@d =t=t =5t=u=t8tEIuPl=t)h3HPh3hчjv5u=tt5Lh3hjJVh3hj8 5<h3hj5h3h)j uh3h>j vjh3hNj=t@u}u=u%=u=@t=@t jl$=th hȓ 5<h3hXj5,h3hfj = [I<u*T<thv'`= [I<u2<t'hK'"}tu95c}%P?v<4PtA5$ =u1[@<u =<[@<jh3hj踿[@DLPh3hȈj菿kk 8u1h'R}6}au95RZ5kR0kj5khֈj[@<u|k8tP5kޟk~j<4Ph'5k}XuRh+p%v=t5LT5r4vjh3hLj5 j5Lhh3he5hpAÃ,Sh3hmjhLWh3h~j辽`G߃=f$@vd8DX8dd*6.6=uz=t3Pi v3P~|O5C9] Ã=t0=t u V@=<t=t Vu f158e[^_Í6UE888=O1Ð5h|Í6UVSuVh3hj>|JTt4;t 3${t s؋[tPTe[^Í6UWVSDžjPh3h>5‰jPj@ZTt6[u6j:\u.PPRS 5h hĊ5`ZY |YDž(PP5`Zj 豘Ã=tV})h=tPh55} h7l6{puK0}Ѝp=tVu vuVK9%18Vh3hUjZo=ntNuX5hHjh3h^j =t jCj]1 v=btBu55h.jh3hij蛲F=tGltLu=5hjh3hvjSR1n\u;jh3hj,j\ %P~Ã106j\%PVÃe1\u P%P5hhUj衱 =t }t6=5t 868t ~t 1 6Ƹ ~#%P%PÃ~P%PZÃ|m5h|VM1AMXuj\%P=~5h| v=t hI1e[^_ÍvUS1ۃ=tt'P jj5tI=Du=d t=t5h3hj5 5hhh܋= uR=uI=u vj5/u38tPh"GhD:]ÐUEU tt ct^øot hø3ÐUWVSu oiEt} 1au vU4蘖t9uu U4谔 t!uu Ut 菔 tjh;h_j!;&EPEPS5A } EE4Yu t6UE9Y} YvE<t7j4h_j螦}tE4莐Evjh;h_je5S5r4E }PShjj8EEr@<t4Er@Er@|ttEr@D]9~.5r [B BDfBfDC9 r@DfD1e[^ÍvUVS1ۋr[DfDC~۾1V1҃  DŽJ<tB~C?~1ۍvWC}~1ېYY1ҍ RBǀlǀBa~C~e[^Í6UVS5h3hwj,=T{ts3 v3[u5|1ۃv@P42ltRj_%P <@PlYYǂlǂC~=<v[@<5<h3hj=<~U<4P<<t4ʌ< < x6<g[@<N5Lh3hja=LLP4dZhj8LP4hjL3 Ph3hjkLP4hΎj١L@ ?.L<t4贋LLP4h܎j脡 L =L~ LYY"YY 6L=4=th hȓ 蒠P1e[^ÍvUuv?51ÍvUSE$L p   (      =h9wjh3hjEHSjMI=h/L_jv=h0HOjv==hJtv=tjh3hhjt|Mgjyxv==tahU6HGj <;6 u SS Ph1]Í6U帾}tÍvUEtt !tÐЏÐ̏ÐUVSuVh֏M%t.ӍB߃]vRh vRh T<th4T4jTh?v t<wPhK6PPhO 8uhVh=e[^ÍvUS]8vvt t<w Pho 6Phu>Cuċ]ÍvU W5hx5|h5 h=t!h(hh0hh:tWhȐ EP MQ0ҋ}JRuu萂 Ǻt֐R_EP XMQ0ҋ}JRuuD Ǻt֐R 5h5Th5h5|5jh$5@h5 h5 h5,5h 5D5ht55hdh=Z}ÐUWVSu} h>9uh -vtth  9VWHwh$        $ , .>46?.J&WdoyvtSYttSEt ShKe[^_ÍvUSh=2h(hɑ=uPhϑhɑ=juPhؑh$h {5$Ph؅ȕPhh5Ph6J=tDPhQhm4[=tVPhb5Phmh3=u=u=uz=tPhShhȧ5 h5hh(=tHOPh5Phɒhzh=p(4=tϒP4@%P5hӒ),5P5`5hVPh h]ÐU=thh  h8"Ph-ÐUWVS蚦 UEPh=j5GPh{p5 PhZ h=Mhh>E h=*}uhדE6hEU:u h6hE16U<ti1ۿ8t8 u@C8uEEH9E|h]U4uPfF~}~ h=JE}h=0e[^_U5h5VPhHÐU5@:Phe5D$Ph[<tQh54h˔5<Ph~5Hhn$1<t,Qh9E=`} hV/Ð`4PhÍvUWVSuux1‰p2!hPLjyP}h1 6#jh=S* Džp=~]srpMp<H;sL>HD;D>pGp9=]Shs5Lj5h3h3hԕj}W1(uVj5Ljjh3h3hߕjS1(jjjjjh3h3h3jV1(W1ƃ,lt t 66t'-5 k5|Y_t/ƃ} |Y|YU:5R5rƃ t(@uh60=|YHp195p5|Yrv4x urt4F95vrvt4ivhDžp=86rpHp<t:4:ƒp@p9Fv+.‰p?$P( v\) . 7 7 7 7 t) E E 8 E - ) 9 h) : : X1 1 3  . v. E . : ,; P) E E D< < < < < (= E E E E T> > E > > ? E E E E D@ @ t@ A B  B ,B E (C \@ |C D E E E  06J664h0gvh4h!(4h9L4hQP4hi$@4h4h4h4hɖk 4hR 4hPPhX5PhuT4Phd(5PPhK4Ph̛-5$nPh$5(UPh55Ph#h'h@ h'h] h=c=toRhzh J=tDRhbhϜX =<uhE<=<t16;w4@%Phߜ 6PhuC;uh==t5h6h=t0RhH=t5h` h5Phi5PhS۝=u3R5hݝ, ۝=u3R5h 胋2 6Ph v(4=tϒR54@%Ph  hPLƒ}hZ "uhaZRh]I=Pu E/=Pu E6=Pu Eb 6EZuhg=Pu-=Tt5Thu6hh=(#= = hh 6C5=@tRhU5P5`C v37n 6b 6=t=u6Rh545Ph.5XhG ubR3=tlRho5Ph~~ =juRhZ5$khJ5HPh֟45uPh(8P\Ph5FPh5,h8 50hMh'hbhh5h j@hj h͠5hPhm=TthbhXhK6h:q=duh!XdJ6SuRjsP3h([ u66=ؐu)hA\‰UthRhؐ` =ؐtؐRhHx=ؐl=ؔtؔRhWJ=XtXRhe)%=Xu)hs\‰UthRhX)` =XtXRh{=X=XtXRhW=؝t؝Rh}h=njf6h=VjN6=uh5lh&1ۃ<t4hC~h=t5h h6=tHSRh=tL_Rhu=tHORhT=u=Htg=u^=t/=u +7RhMgh= =uPhWhivhl=tHGRh{665PPhz5\Phd5lPhâN$=u =lt=lu=PthעD=lt=lu=Pu h"6=lt=lu=Pt h65D3=`tR=p~3Rhv=tRhv=j=tRhУHDh=6tuRhuRh5\h 5xh=5$h*50h84uRhG5(hW5,hho8uRh|R@uRh5<uRh5HhDuRh5hǤ6h֤VEuEhPhݤuRhuURhq\PPh)X\PPhB? uRh["\,U{Mh=ag4h=,hu*vTh8[^_Í6U5Ph =5,Phi5PhS5Ph=$5 {Phǥ$5$ePh54OPh$5<6Ph 5D Ph5L Ph.1Ív1UWVS]u EjSh?jrjVhIjr kShS^0ЍxZ(uE)uM}}E,u&}u j,huj-hu Phu u*j hu> u6F> t2G0H9~&j-huj hu(,9~JtIFj hu2,9~dJu 1e[^_UEU 8t 68t@8u8t1Í6Í6UTWVS@<DP t@@DA u@~&$@I vPK \K \K \K \K \K \K \K \K \K PK \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K \K HPH5L Ã<+t, #tM뫍v-t#롐@tG >tp뒍6|t뉐5L+5L5Lov 5La15LU5LVL;vL5L$L5Le[^ÐUDÐUhH=HEt&=u= u hĦ<LÍvUS  u  ]ÐUEu 3Ív<@dPh]h[Q3=<u[ÍvU=HNu DLe=H(u3H=H)tC=u0= u'h=u= u h<*HÍ6Ul=H!u H5LLÍ6US=H-t =H~u.HH-u L6L]Í6UWVSUU<w UE<EE4YtU\uV<vVh7v0HVhRv:%uzt hrv:&uz[t Vh6:%u+Z<DXtM M:&EPEPRSh3h˨jaa}&u uurUt+Vhݨ6uu}hEM EMe[^_ÍvU VSUu :\tRh+SIڃ M艍DžPPR؁ |4E艅Pnu'PPu 6jj j3B1[^ÐUVSu] EPV0} +6}t])]uh2]Suh=~)h=蕻C,9~-1h=lC,9~ -to160== (~ H9 I=O~?h=C,9~8-u1-1VhӺ=vVh轺Ue[^_ÍvU= h6u hnhժPThݪPThPThh5|Yc;$5|YPoThh5|Y&;5|YP5ThPT$h PShPShPSh%P~S h,PWSh6P3Sh?PShGPR j@hO5|Y95|YPRhhY5|Yh9 5|YPtRhhf5|Y+95|YP:Rh'ht5|Y8(5|YPQj@h}5|Y85|YPQhh5|Y}8(5|YPQj h5|YC85|YPRQj h5|Y 8(5|YPQj@h5|Y75|YPPhh5|Y7(5|YPPhhë5|Y[75|YPjPhhͫ5|Y!7(5|YP-Pj h٫5|Y65|YPOhh5|Y6(5|YPOhPOhPqOhPMO hP&Oh POhPNhPN h(PNh0PoNh:PKNhEP'N hQPNh[PMhdPMhkPM hzPmMhPIMhP%MhPM hPLhPLhPLhPnL hPGLhĬP#LhҬPKh׬PK hPKhPKhPlKhPHK hP!KhPJh)PJh3PJ h=PJhHPjJhRPFJh`P"J hiPIhtPIh|PIhPI hsPhIhPDIhP Ih PH hPHhPHhPHh­PiH hʭPBHhӭPHhۭh5|Y.5|YPG$5h3hjBFjjj55PÐUVSEH5hh֬EE, 9E~ Eh&袬EE,9E~EhYnE,9E~Ehp=E,9E~uaEh E,9E~D0Eh۫E,9E~Eh誫E,9E~EhyE,9E~EhTHE,9E~lEhvE,9E~O;EhE,9E~ EhƯ赪E,9E~Ehٯ脪E,9E~EhSE,9E~wEh "E,9E~ZFEh-E,9E~)Eh9E,9E~Eha菩E,9E~Eh^E,9E~Eh-E,9E~eQEhڰE,9E~4 Eh˨E,9E~Eh蚨E,9E~Ȅ=(t(Ph+UE,9E~yȄ=jtjPh<E,9E~H4Ȅ=tPhM˧E,9E~Ȅ=tPh^膧E,9E~Ȅ=0t0PhoAE,9E~ytiEhhE,9E~Gt7EhhhئE, 9E~u 6E19~%u4VjC9h3EPHjhɱ5|Y'5|YEP|jhٱ5|Y'5|YEPPjh5|Yo'5|YEP$jh5|YC'5|YEPjh5|Y'5|YEPtphh5|Y&jh5|Y&5|YEP t3jh5|Y&5|Y]Sgt h3SU1e[^UPWVSu1ۃVjhh޲hG}'uhU輤665]S}\u E<w]<w hhSF Et xj  hna$uhF65 5j eP5hj<=}!j S1v0H(RS=PShj<vjhh޲h{hh45蜁P誚6uPj&5$=t5L辚=~ 聛V=(k(k5Lh޲h޲5 h4}du#h#3I=uh>5:6=Y6Eh4m=(k6gP*5SPy =~9hX{EEEPS(PSh[ju: h4Ԙ=.hlv=(k(kj=uBvjhh޲hxrP5hj9 薙=t5F=(k6u hXz=}Fh4=uhlNv8tBPSیPShj(9h4薗,vh4nSe[^_ÍvUDjhh޲hG褴} uhUqÍ6Ðj@5EP5Lhj hh蛞 |a|S}9%P5EP |ÍEPhҞ1UDWVS1=t=Dk.u=Ek\u =Fk%t =Fk&uEk$=u[Ew5Ljhh޲hҵN=}!=u hUy665]S }\u E<w]<hhS b}zuEJSҎ05h޲hj6t2jhh5h2ƃ~E7=ucjhh޲hʹ5{jShj6j5h)j6$6=hhS  U=`uh7蔜8655o} 6jhh޲h\jShxjS5j5hj?5 v}zXt2jhh5h·ƃ~E7jhh޲hfXjShj4j5hj4 8{u20H~ |}uD8}7t}Xu2E(|YqEPhq5qU|Y u5$P5|Y 0HPRhͶj35Sp}4}7t}XuܶPh|16Ev e[^_Í6U塨u޲ÐUE|9|=~޲ËÍvUSU] u ޲lvك,tZ1tU'tPtK_tC7t>t6)t1Bփv)$t$t`t0tt !tfu;0uAȋ]Í6UWVS}u =upVWLu919p~ v4W+tC9p19v/19p~64VtC9pe[^_Í6US= t_55 5r蠃 |ALjuP ~)9L~jn9LL1]ÐUWVSpDž8EuPhj]1E<_t4_EE_=u h Dž,޲}t= t  ,Dž(޲}t=D t D (Dž4޲}t=@ t @ 4 0u Dž0޲ƅh5>+tEE(V,4h hSS=ƃ v1E= u-} otih)]Ƅ+h: t: t=tf8(u+D+=uHVh_蘖c 6 <DPtD+C8t~Ejj jPd1ƅh: t: t=tB8) <DPt +hC8t~Ejj jPÍhPS$ v: t: t:$8 <v8u EP5 *=$ u} oh}EDž8޲}t=$ t5$ ޲}t=( t( (Shh*(S5$EPV,4h·hP8$0= u} otu hӷ5=uuEDž8޲}t=4 t54 ޲}=8 8 EDž8H6EDž819Ȳ~$64$ftC9Ȳރ8u=}t =H u޲}t=, t5, 65H ޲7v޲}t=, t5, ޲}t=0 t0 (S5$V,4hhP;$BvEDž8}t=@ =޲}t=4 t54 ޲}t=8 t8 =u(S5$V,(S5V,hhPw~v=0=H<195~D̲0щK9<~jS5Ry-tF95=4̲h|,V5|h%jg*Dž8 < tX9\uSQڡ<DXt0=vtfu/Dž@ HD@PDPQ0Kك ޲}tt(5V,h hP&6޲}t=4 t54 ޲}t=8 t8 =uC(S5$V,@ u޲RhhP$(S5V,@ u޲Rh hPG gvDž 51ۋ:tI<DPu:t DAt+@C~Ƅ+@Dž 1=19=p~_@v45 hV0Ѝx~jWV@P*C9p uX05 h@S 0Ѝx~!jWS@Pn*u Dž t E޲}t=4 t54 ޲}t=8 t8 @ t"0= ЍD v(S5065 h4@S)0Ѝx jWS@Ps)utE޲}t=, t5, ޲}t=0 t0 /@ <v(S5p6E=$ u} othD޲}t=$ t5$ ޲}t=( t( (S@PV,4h hP (Shh hShƃuVE_P&8p1[^_U(WVSE}t/} t)0}H~hÃu 1u EPu讲uuo}u蘌`vh7us E uxug/6h9uC ƃuuB uuh;4uhiV.hhhhhhV 4vu hS# ;uhʸV؉ύv0ЍPH~6< w IjEPjS=|uD޲A~uuuuuh̸V]QhBE} t u b t VU tS8 E؍e[^_ÐULWVSEE} = 0}HE܅hEu-h5hٺ苉 QEEEEEE}E9 h744 Eu0E44}tu EE띐x= t}uE44h賈E}uEE1EEjuhPYƒ})}-uEEE8}0щMQ,ÃuS&jEPjS}E8;uEv}E8+uE}U:=tvjjhR#t`jjhuz#tHjjhub#t0jjh uJ#tjjhu2#ut ST u}tQ}u}t;h hZh }u v}E=uuhڹ詆hƒ tZEHPuE44Wƒ }"Eh,]hDS6EEM6=u h{!Et jEPj jEPju}}0щN9u}t 9uujuuu!Z}P}0ҍB4RzÃu hj6uSo==uy=t5=FPu1h}tu 6uu5ovU0щHEE9EujPR5r 3}uIE19~-<t4rC9Ev}t uB=u.}t(} ou޲Ruh2ve[^_ÍvUS]EE5EPU5_EPFSh;jjjoj (=_u Pj5_hP uhuh_jEPjEPP]ÐU8WVSEEEEEEEE PPhOjEЃ= t/jj j5 ƒ}}EuE }ruE(hE h E uE}o=/=t h^vh 15 =u#hh 1 v=u;=}2 th要 1 }St<}quR5LEPj hhˀ‰ E ߶‰^ 6EO= ~E#5Lhtu޲Ru螘‰U =t@0҉߈ҍBE~;{u|}uDU}q1ې=tu?6<tG4<_t4_b_C~}u =uFtu8}ouh^ v}SumRh 5hl`lE5 Phj1ۋ <DPC= ~7uQ[Eԃu$}ou޲R5h˼4 u5hj@}}}ot}h~}~6E-8=u"E v8 t}ouvur}u5l6u޲:t(R5lho~vhN~1m}(u=hu} u}ou}O5lht}2= uR=uI55u5h.}v55hK} }ot}~R= uI=u@t}~rR5x}uvRuh{L}E؃19u~36uuuV} }oF9uσ=}1EH9}vMI6^9]~c9~M____C9]F9|}ot$} = =}ԃ}ot ~ 19}:4_uR4u؍^Sh{9|ǃ}o9}E)Phڽ{xv}uo}tlRhO}t 6lRh+Euuuj?}oE=l!E=~x5lSEԃ}}~E}ou}u5lhzJt}~rR5l}uRuԺ޲}ou Rhz19u~m4H4H5FPh;fz16HtHhQ7zG~hʸ$zF9u}ouE䣈E5EEƃwjfC=ud=u[sÃ~Oub}quURhiyu( }quRhsy}qu jjjh޲2v16~uЍFPh'y 19]v_94hx=u .=!5hxhͿE hh4Cph p5qE=t jPp(kE(k‰j}})6jhh޲h%誏Ep}|0=Hh4fo65_PY5VẸ(kh4,o @d@1҃=htRSV5(0%@du!= ~+=  t"= t} tC9]~ === =  = } F9u=u:= u1x=uvR5h<vhvEQm%t, =t1j n =ujEM=}otL=u6  3v= u jhu}~EEe[^_UWVS]Dž Sˊu jShSjyu!jShjDžM ,~T=~K= ~B, 0Rh޲hj50h޲hj ]vhVjK ~w} t-0H=0@=,~ =0~Vht} t=,~=0~,9~t 1v6j}Ph޲hjS  [^_Í6US=t?19~ <t 4C95]ÐUVS1hs=p~3=pt=pu Ph4TsC=X~"=XtPh4)sC=T~"=Tt Ph4rC=P~"*=PtPh4rC=t~"?=tt4Ph4rC=|~"U=|tLPh4}rC=\~"k=\t`Ph4RrC=l~"=ltxPh4'rC=x~"=xtPh4qC=`uChqKv=`~?C=hu  6=hu=huVhq=d~"=dtPh4mqCt޲PhPqe[^ÐU$WVSEEEEEEEEE15Lh޲h5$h}6h<:t<=u = Jw$4 v     ̰ ذ  ,           ȯ  ȱ Ա  1-"6EEEEEEEE666<:t<=u05Lhh"5Lh(:\ MGv1=E0E$EE EEEEg}hn~=X}~ M T}~ M P}~ M \~5`}~ M h}~ M d}~ M t~p}~ M܉ x}~ M |}~ M le[^_Í6U4 WVSDž8Džƅ=T~ T  P} DžDž =X~ X \} Dž ` } Dž d} Džt} Dž p Dž=l}1x} DžDž=|~ |~&=~= ~, 0xSh5Lj5$h޲h޲h+jQ=(TPj5Ljjh޲hJhLjS (jj5Ljjh޲h޲h޲jݢ(6PSh޲h_j =,l0c<:t<=u =4l  4lKw$`  е        ض     0 @ ` p P   , < L Dž %Dž DžDžDžDžDžDžDžDžDžDžu1ۀ:t =u-5Lhh"5Lh(ÃC Dž h6Dž DžDž61DžDžDžDžh(50l5|Y|Yמà $ =,lt5hmi vt 4lS5hj5#0ۋӉЃ8Rhj89/u hJ6h5L8P5hjY5t tt p5ӌtp5,5uVhg v tL tCPu*= uh^gh#TgDž t05`Zh(55`ZhFg ui jh޲h޲S=Xơ} vShYfvDž$Dž(Dž,$P6uj5|he[u9z0t t 6u`i=ƃu޲>u pFЍffFffÉfHf wËt4 Dž4FЍffFffЍDVЍDVЍfffFffF ЍffF ffF ЍffF ffFЍffFffPPPP4PhF?ƅ@-FAFBƅC-FDFEFPt=0ӉK=VP t{0Ӌ9}Su uhLaK34;裇 h`u tr=0~<0Kؙ=0ӉƅƉ6,9~Dž 1ۃ8t:5ht t ~twkc [5htt Gt??3 +h_115|S551ۃ9v4h^_H9| =0~r0N=0ׅ0N=0,9~DžC9t[$u޲S$(u޲S(,uS,h!^[^_ÍvUU=uuÐYuH5Lhh޲Pduh(55`Z`Z |m|Yqh}[u5Ph5qj5|YhjP 5|Y誩%UEU V$ v8     $   H T ` l x      <        H840,($PL <=u D@p<f6Z6=F>%666= $6(6,6064686D66= tth [Í6La= tuأPLE =5t Tt tTu h띍vT ÐÐUPWVS1]Sh,5Ljjh޲h޲h+jEPh(jj5Ljjh޲h޲hjS@(EP{Sh޲hj3}$tu5 khYv=,lu =4l맍v=,lth ?h(50l5`ZAà =t= th-|Y6j5`ZhSjEE1`ZP$~ thʸY5`Z`Z8P&nÃ|Q5`Zp5`Zn}]EtF5`Zh`KtF5`Zhj/tF5`Zܦt 5`Zh} 5`Zh`XHt\~ hʸFX޲}tPu޲}tPuhXvt5`ZhWe[^_ÍvU<uhWÍvLV<uK=L =<~ TPQ65PhʸW=t.5LpO!6jhh޲hn|1ÐUWVS5Lhh޲hG5l‰:\u#R5hUV6|YUEP0ۋ=|YщHEEEuj5 khj5 ku= kщHEEhvPME j5|Yh%j_jhh޲h.m‰ 0=H vEPhJ}h>U16j5|YhTj5h]5r?}Jhh]@5h]5rq?}hdSU18j5|YhjT[@tV5^e[^_ÐUWSjhh޲hGi}hUThh5菋‰ {|YqffBB0=|YHqqá8\uqqu qq q5LEPj h޲hVSuh޲hj k0ҋ= kщHvuh5`Z`Z qqtqqu qq q5LEPj h޲h~Ruh޲hj k0ҋ= kщHuh5`Z+`Z qqtqqu qq q5LEPj hhQ} vuh޲hj, k0ҋ= kщHuh5`ZA`Z qqt!6qqu qq q}} q< q>qq qjhh޲hh‰0=HhqhW}h>P1v5h5r: }Jhhh;5h5r:}hsP1Lj5|Yhjt[@tS5~vhPe[_Í6USh7PhOhOhOh Oh>OhO ,9~X1hOh#O,9~#1h6dO,9~1hV9Oho/O,9~h1hO,9~=1hN,9~ tq1hNC,9~ tL1h3N,9~ t%1hrfNC,9~u1h>N]UWVS]11u޲;u vjShj!<DPtd C<DPt L C;:u:C<DPt/3C<DPt ƍt2C< ;:t ;tAgC<DPt;C<DPt Ǎ|:C<Ā; wIAvSh޲hj?؍e[^_ÐU0WVS }>u5Lhj hh8}u5Lhj hhB5Lhj hlhpL ==`ZEE(EPEP5 k5`Z ƃ}h-L,vM؉MԍEP=Eԃ jj jPÃEԃjj jPǃEԃjj jPEЃ[CE9}ƀQ) 6=} }>t }tWi}]ubL65Lh޲h5hgt0 Ív賀}6~5}]u#| P:v}u&=u5jQBYv=tAu݃}>u =t}D|9#9t;j =}>u081/6v=%e[^_ÍvUW5Lhhh޲hUM}h+l6=t hLW5t5hrI55|Yo0=|Y|Y)ʉ5LhhthsJ}u h655~~~j5|Yhjj5hj 5|Y\t hP65]~M=tD=tu=ut = th19Hv55|Yrwc$      5|Yhdv5|YhG}UlWVSDžDžDžDžDžuh޲hj] 16DG~}!}tO } t[6}ntb}}txv}6Dž DžDžEqDžDž$VDžDžE36'DžE,DžDžSh1jh޲h=j u!=HtShH<vPDtR5LjtRh޲h޲ttRjP9s(u tLPjHHv 1҃uLRjjh޲h޲tRj$Pj5Ljjh޲h޲hjPr(jjjjjh޲h޲h޲jP~r(PrPh޲h je==,l31:t=ut 8lW4lSh޲h:jg$    L L L L L   L L  X   @   L L  T | L L  = =| t/Dž#DžDž|EED5Lhh޲hN} hL v<2t 42Ӽ=0щH= 6 jhh޲hiN- 5 0҉ψщH<2t 42@P<7l5RܲD7PWh޲h0j3jhh޲hDM}X ޲5 0҉ψщH19~.6 <\u| vt9ڡ9e <D7<7t4770=H4@P蔳‰ރ5R舱N5Lhh޲5`h$&v5Lhh޲5hR‰ T5Lh޲h5@hR} 55 khjTh 54lh 5,lh޲h&jm|Y`Z1`Z,lt8 t6h(50l5|Y }t;h(50l5`Z0=`ZH ~"6h(50l5|Y辴 Džv5,lh:j5hYjth޲hej] 5}~pjh޲htj!jhh޲hL } =h(55`Z 6jhh޲h5P5hj =} =8=t0h(55`Zei S5hj$u)}th(u5`Z v`Z5Mj5hjj5hj$8u+} t}nt}t }u hv}~T8u h!v=thF=|th13l5lh޲hhj}~&d~ Dž$~ Dž,~jhl(}" ujj_u hvHHwt8u hd~EH0L\}UHЍ (| ~ D HH (| ~ D HH (| ~T =t HH (| ~ D 0HH (| ~ D LHH (| ~ D \HH (| ~ D HH (| ~ D HH (| $~ D $5Hh޲hj35h޲hj ~ 2|~v}~ 5h޲hj5 h޲hj }~Q|}u|5v0}P5‰|t uR-}~ \~ 5h޲h(j}~'EԣPh޲h5j}~'ẸPh޲hAjtDo$~ }~ d~I @t v-6$~ h6}~ jrPh޲hOj=t\t (=l}0ЍH ~| /t5{j5h[ja=Lu#hs-޲h5h3 5Kuh5h,6h&hFhqhhhfr,Ov޲h5hHKyhhHKhjOj5hj;,1<t 4G~[^_Í6UWVS}gaTu5Lh޲h#vUt 5Lh޲hj=L5h޲hjzE%eM0e10Љe ETuq=Lu WvLlJVShjSEP=L7L4P]Uv LLV KhjL KEPL=t\5h޲hjU4h޲h(j6 th޲h<j DD[DTDDh hȓ NF QT=L~7LYؖYPrhRjmYY=Ph޲hkj11ۃ9SY4hj C9lL?~16LYYPrhj5YYphj Vh޲hj5Lh޲hjh L4Vh޲hjHTu.=L~%L|VVRh޲hje[^_ÐUWVS} %EEu h޲hj5h޲hj 5Lh޲h'j5<h޲h3j juh?jo0}HE];:t&U~MD J]:EMuuhVj]{.t { t{uuhl&9v=uh&6=M̉x6[@<0} /uL4dZ L40+E|PVhjEE|>{uE 6>}uM}t }S>,u D;> 2>:'!pU1Ēt)6G2: v:,tBppuuuhj舾Wxhju }tdE1]]EPEPxj1SxREj[4ux9%6jE9}PxutA}t&j~Pxht1EF|9]v|9M5h޲hj耽}=LLH4J[@<jhJ tijhLH4żJ tFjhLH4żJ͢ t#jhLH4żJ誢 ujU[Suh 6jVh"juL4v[@<Džt} /u$<4P<d[<4PӞ<4Ph(5|Y <d[5|YF> t> t>:u51>tv8 v>G8ujE9}PuV4uDžt6΍v}.j~PxhDžttu55h޲hj}u7uuh 6t=uh9!1d[^_ÐUWUu ޲'6:{u0Ѓ<}uBЋ}Í6UWVS]10H 6v;\(SE\u  6ʡ<DHt <vЈ€%u E6&u{[urjjjShTEY$t VtMu{(%E9Fu4jjjShVʹtjjPShX賹t}tRE(|YqEPhqSq|Y0HEPRhZj}e[^_ÐU8WVS15Lh޲h޲5h ;}Uu ha 65 kyrt'&6=u5 khv7='u$jj j5 k' v=%$ v |    t        | l  l   |  |   |     |  4 P  \    56jh޲h,61jh޲h=Sh޲hv=Sh޲hvjEPh޲hҵ2E}` vU:\uRRÃ!v5u5rD Suhj6=u= v=  <؃}IuSh޲hj 5LEPh޲=uR1E} =$ u‰U=!uR詠 6=u+u1Sh޲hjf 6ujSh޲hj@ E(|YqEPhquW|YEP9jSh޲hj l 5LEPh޲h"0E} h> 6u M0҉ψщHE=(~hNU|YquPU5LEPh޲he<0E܃}Sh>! vuM0҉ψщHE܋EE܃=(kEquPȔ[4j55qE tt ' t}v] }Sh޲hM65LEPh޲h;/Eu h(6}.uh޲hj|YquPj5qhj(jjh5q蠵u46jjh5qpu 5||jjh5qLuL4VRv5qMltjj j5q%5qQIS%l jj jS5LEPh޲h-E܃u hv}} E{ 60}HZ 0=qHEE|YuP耒j5hjxjjh50(u<6jjh5u =||jjh5ܳuL… k8^uNxuHX<DXt<C w>…|g4@%P65 kh_'v5 kh~v}~}tuh/=…| EЍe[^_Í6UWVSDžXDžTDžP]ShHjj5xhhhjEP>(uVjjjjhhhjS>(jjjjjhhhjVs>Dž\Dž`(d6EP>0=,l1<:t<=ut 8lI4lt+ tytDžX뀅t@5Lh0j hh c 0IT>6DžT-t@5Lhhjh," PvDžPjh8hh358k8jPtS1tyo؀;t ;:tcC;u=8hh8PW58t8t jPW虄 W TuWhD6C띍6jj jWH\F;[v6,lt u-Avh(50l5|Y|Y8 v5,lhVfv1Ʌt huC:0i5870}58h60Yu58hT6\} Dž\`}0Y`0`9Y}"4YR\h\`)F2`PhvhnvT} DžTX} DžXP}[PPXTVSD[^_Í6UWVS5Lhh5hhǃ5Lhhjh\8=Dh}jShj諛u;t*=t!S5詂VSh"ju1jSh1j_ShH)1 v|Y=e[^_ÍvUWS]tJ5Lhhl5hh,}Nu hvu 65Lhh5 h`PC =' $t vP! " $  h ( ! ( ( # ( (  ( X$ ( $  & ( $& `' `' h( 5Lh4j hh44vh1}636i=4u16=4"5Lhh5 hP0540\=d,pH685Lhh5hl~0q)54_0.v5Lhh;5h(044 t2+0PhS5`Z肀h5`ZhVHH0DjhS5`Z.5Lh4j 5`ZhZ h 40Vt+54hS5`Zh5`ZhmD4 5LhhqtPdtP030PhS]S2hSh65Lhh5(hd0W3E= t hv=tu=u u h60\HH@t'RhS5`Zb~h5`Zh=\u =\sdh0l=t\4\$5Lhhjhغ$10t6h=tPhjSj%<5LEPhhÃ} juh0jĔuh=c5`Zh(uQL t!xtP0H~Ujuhgj\u5|YBu|YE0Ã0=|YЍX=t5 ~CPvv5|YPte6?y65Lhhw5hT0G0wO5Lh4j hh=454h/0|=~$3%\4Xv=0%`=Pt5P|54uPuh|jj-64X1DŽ5Lh8hhG0|7585|Y*s5|Y8PPG裓~=0u z.019Rv=0~2=u6PD{C9~=u j jP 056h 0| h&[_ÍvUhhJ1ÍvU5Lhh5h=4$) ) * * * * / - / / / / - / /  . / . / / / / / / . . / / / |. / / / h- / / / + , / / / / / / / / / / \/ / / / D/ 5Lh0j hh0vh1Ív,K=0u =0uÍ6hfhZÐ5Lhh5h$0=0u<[+0`PfP8Uv8= |5P6@D9\t9 }5L58h5 hP*40P`6P8Uv8= |5P6@D9\t9 }5L58h5 hP1*)4E65Lhh5h$0=0u$)0`Pvc)40Pxv5Lhh5Ժhd0])K0$v5Lhoh5 h0 (0(Ð5Lhhhjh0k(0v5Lhhjhpi(0W==u = hÍv0hhÐ5Lh0j h(h+\{'0 v5Lh0j hLhj |}/'|o0Hvh$0|J-5Lh8hhm|jh58ÐÐUWVS] u=|Yf=|Yf} t@5Lh5|Y5hl }G h%5Lh5|Y5HhO ‰!o $x0 v2 x@ x@ x@ x@ x@ x@ x@ x@ 03 x@ x@ 6 p7 7 x@ : x@ x@ 82 x@ x@ x@ x@ (8 x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ L; x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ X: x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ L; x@ = x@ x@ x@ x@ x@ ? x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ x@ |? x@ x@ x@ x@ x@ x@ x@ ? 5Lhj hh‰0#‰0߃v w* uh ix vh 6h4hDi‰ =4~ hGL v u4g64fv5Lh0j hihl‰ 5 R50h4‰ =Ht)HH4(h h =4  h~ } t2`Z54hSPCnh5h 6=H=4@#~ 4@#55054‰ 94t1u"=t505h9 HH,^=^щ 6HHw-=4t!=4thMhsR 4A5$550h4h‰> =4  h 6=Huo=4@#~ 4@#4550P 9t7̮u.=t%505h 4HHw/=4t#=4thMhs@ vHH(D D==H=4^~4=Pu+=t"==4~ h =VżGv 5Lh0j hh* j~P50h4x‰$N u4av4`f=@j-65Lh0j hh j^P50h4‰ u4Q4|B6h4h]‰ u4e64dV jhS]Si5Lh0j Sh= j^P50h4 ‰} tC`Z54hSPih5hUjSV%4dV5Lh0j hh=(u0l6=} C6=0|l5Lh3hjh$7‰4 =4t}5LEPj hhm‰}50hY5LEPj hh=‰Y‰n4p04lh`EtEx65Lhh5`h$ ‰‰0 u'HHLjHHHC65Lh0j hhh:P50h4i‰B4H65hhaÃu h1ҍ6fUxfSB~x6 5Lhj h5uRc0[ =0=0't Sgj5 khj}jjh5 k肀 tUjjh,5 kgt:jjh05 kLtjjh35 k1‰0v Ux5uff Ux vff W=~ƒ5u pX7t(vh536Sf0Q = K5u6fK5u pXt6‰01ҐfSfUxB~Sfijh8huR{‰}88uRu%=xt5xex6=|5|e|58 80҉ψщHum0=~,8 0<\u| vt009ڡ09u h)hvu58hx 658h|\|$v5Lh0j hdhgjP50h4L‰%u4\4`5Lhhjh‰‰0uddvhU5Lhhjh‰|rH‰0|au'=%76hj$vh`RStce[^_ÍvUW5Lhh5hp)=$@ vhA A A @ (B A 8B B 5Lh8hhV0=8H2~j2h!tv58h<tYiv5Lh0j hhCjP50h4<4hJh:5Lh0j hnhq0jP50h44h5Lh0j hhhP50h4%|m4J5Lh0j hhhP50h4|!4}Í6U=t h-US5LEPhhO0=t5`5hhjevjuhjTv 5|hhj:vE8uo==|tG=|t>=|t5=|t,=|t#=|t|v =|A5kh6E>t|thE>uE8>uEEE8 t8 tE8u>uPh>u'u}uh|%uhv=t\5hhjt5hh,jt 5hh;jtj5hJjt]ÍvUWVS=t5M^M MuE}?um==|tG=|t>=|t5=|t,=|t#=|t|v =|H5khlE0}Ѝp|M}t>u|uuNy}}=u^=|tC=|t:=|t1=|t(=|t=|t|v =|u5kh6uXE}kv~ރ}~9]} uM>u|1>u ]@vC; t; t;u>uPh>u#S}ShShs}\>9vv; t; uK9]rCudEM=tp5hhYjq5hhhjq 5hhwjqj5hjq juhj|qe[^_ÍvUWVSE1EEE=u 6=tָ}h65Lh8hh0} 0=8H@PSE58uQ5Lh8hhkÃ} 0=8H@P Sƃtj58VQ5Lh8hhÃ} L0=8H~;@PREuh658uPh8Ã}(kU(khh4Ejh4hjBohP j15L0jh8hhq0|0=8H h@PQE58uOhP6j{5LD0v=0t'jh8hh0|0=8PPƃuhB658VNhF Ã|uVujIC1ۃ}t h4}~ U(k}t uWt VsW}t ubW~=t褮؍e[^_Í6UWS]+ |jjMu hG uS5Lhh5hL{Eă}u hU 6E juΎ s $`M TT M t,SVhSjbhhVSv8%vh5f1e[^ÐUS]5LhhZ5Xh=EP\4thqE  $(,048<@DHLPTX4LvHwY0,=%thtRh5Lhhjh4w0}$Y 6HZ Z  Z |[ |[ |[ |[ Z |[ Y Y LY LY Z |[ 0[ HZ t$h=4tPh4XTPL6t$h=4tPh4 t$h=4tPh[4 t$h=4tPh4Ht$h=4tPh4($ t$h=4tPh40,t h=4tPhn484t h=4tPh64@<cvt4h=4tPhjS_4%/64HDvh6v]Í6U5Lhh5h\= |$[ \ P\ \ ]  ] D] X^ X^ @^ X^ X^ L^ 5Lh0j hh4j^P50h8HÍ65Lhhjh,40 4Ð5Lhhjh4zs0h [h<5Lh0j hh4jP50hHTÍ6hhS5`ZD5Lh0j 5`Zh4 4=t"5.F40@P>8u1Í684040=400094}ch@·hD趷1UWVS1=95vcjEPjV}H}>}4M9;(0҉ψщO 9}}t 9}juuuZuEHPMYuEHP4YuEHPYuEHPY uEHGPXuEHPX==u=t5AGP9u-hd追tV@6}u57vU0H9EujuR5FYk}uE0t VR@=u}t uh e[^_Í6US15hhjV=ts}t jZujhhjU 6n=t=t hrjluZ8=},=~ v=t =~5th5|t薎 v=T~ TP P؋]ÍvU WVS]DžDž1ShhjuTu hhjaT  =Dt hHv=~ u} u Džhh8jSƅ  u} tC5Lh8hR0}R=u  u hh6} u0Qv585|Y;4 6|Y|Y8}, u=t h`h hyT 1K u8pPh5Lj5hhRjEP(t  u"jj5Ljjhhh[j jj5Ljjhhh[jpP)(6EPc0Phh`jR=0}=0t0C=0ub0'3v=,ltC50l5|Y2|Y8=,l=,lW1҃:t=ut 8la4lt7 t tC tZDžDžvDžDžv Dž 5Lhh5hh|0 0kvj5|YhmjP Džul5Lh8hhv088t.h(h5|Y6h(585|Y6|Y858[8PSmQ5|Y0jSTQ|Y8j5|YhjOj PhjOj58hjrO8 8jPhjRO=58€8tD::t88:u88t$j?858 P5 6 ffuc5Lh8hh} 0=8H?~ h658h`/=8€8t8::t88:u88tj?8586F|Y8*tR=5u5Lh8hGv=5u5Lh8hh)5Lh8hV65Lh8hh~0}  88tj?P Pp3 5t t6t  5LPhY5\h0}8 a0}&% v0E0 5|Y888u.=u h` v} us 0hhjWL558hj?L8 8=uN6888 t585|Y-|Y8jPhjKvv88ti=~5|Y0 =0}5|Yhu v55|YhjtKh(585`Zo1`Z85Phj>Kj ]88tJ0=} ى uN8t8|0} t=t18 }]Sh5Lj5hhhjEPQ(jj5Ljjh5thjS((=EP[0Phh`jJ=0}=007 =0,lt t@v50l5`Z*`Z8jPhjI54l5`Zh"jxI4lttUDžDž>6DžDž&65,lhh/jIhG vuy0> 5hh`jHj}1 688t06t8|0=5T5h058m[~4=uhx hh"=u'hhۮh^Ѯ =u/58h诮h襮h^蛮v=u58h 658hhwhhjmG5hh jVG == ==~P58=uP5h"ʭ195~p4H4H5FPh>蚭1ۃ<6HtHhTlC~hYF95=u Dž 19+ 6VhhXj"F=~4H5|Y&h054Hhh4Hhuv0@lى hhfjEH ?$ht t v v v v v v v v v v v v v 1j5|Yhj*E|Y;t ;:t C;u;:u CW5|YhjD ugD(]=5u'h(h5|Y*j5|Yh%vh(h 5|Y*j5|YhjCtU :u,hh4耙jh4hSj:E>h P_j褚@Phhbj{:'jhShhjP:=t8t́uh 5h Shhj:@Phhj9,|t2 tf6t/[QA1=@(6=t5LdDjh8hhÃt u&1UhU$jj7 =|0=8PE58uuV)EPhh2j8U :_j蠋Shhj8=t8t́uh 5hCShhBjK8@PhhXj28,t2 tf6t/QA1=@`6h]S S0Poj贗=t5LqQjh8hhÃuh6U$jj5 =|h0=8PEuhӝ658uUU U$}tCu EShhj6}~= t\UUVhjU(kU$}t h4ɔjh4hj>6}u}u1҅t/}t u }t u 1҅tjEe[^_ÍvUjjd41USjh/h0j5Hd =T~ TPX=tj yjh6 =~=~=L~LHL=X~X\X=t$h5h jh46=~ =~=~=~ =~H=~=~)Ph/h8j3=~)Ph/hQj3=~)Ph/hijr3=~=~0=~L=~\=~=~=~=~=~=~=~=~=t+=xt5xx=t+=|t5||LdL1ۍ6tPV,?t PWjPhju)ge[^_UWVS5uhjJ)=t570}@P ujh/h"j(1?6huhHKGOMM]1 9 t9 uE@E8 t8 t0}ЍP~"6E| t| uEDJᐋE8\u,EPƒ~ ЈCލ6EEEC̋E8 t8u?CM HWVQhj(FE8t'8 u 6EE8 t]뀋ECEpVh/h7j'HW/HWe[^_ÍvU<E}<~=~u^B? 6^B4@B<ÐUVS]u hA t xP_ ~VPS ;uhKtVPS D3p[^ÐUS=t =t vhP~j'%QtJ t1 t*J6 t!Nt. =t%=u=thgjjj  =tJt tn==|=ohtWv==H=;h|#v=S==hv===hv=t%=u=thjjj =Hu1==u=hhP=@d=v=u&=tH@4ŀjjj b =:=u=thjjj 0 ===\@46==u&=t\@4jjj ==u=thjjj =ta=u&=tH@4ŀjjj M =t)=u =th5ljj =t2=t[=u =th5jj =t)=u =th58 jj =~f=@dt1=@du4v8 ==t$=u=thPjj? =u_="=u=thjjj  ==uM=tDhjjj /==u =th 5jj==u =th 5jjk=t[=u =th 5jj9=t)=u =th/ 5jj=u2=t)=u =th? 5jj=@dul=t=u=t hF 58=@dt =@du2=tX=u =thF 5jjW=t&=u=thU 5,jj%%64= ==} =@du=,~c Pjjj60=== =@du=,~ Pjjj_h=du^=t%=u=th jjj(85t6j 1]Í6US]=g= Z=t=TD;q=u t =H==u=th jjj P==u=th jjj ==u?=t6h( !=tz=u=th] jjj =tL=uC=t:h/jjj (6=t"=u=th~ jjj q]Ulh/1o=@du h 6=@du h Mnh@n=t h*nhn=$t hnh$m$h/n=~+5h h2hm h m=t:t~&t t6ht4h|,h$hhJm=Huhmpv=@du/\@4mhmH@4ŀ-H@4ŀlhl\@4~m =uh hmh ^mU4WVSEẼ=t8 |g=@dt 5@ v5D=@du =@du4}uD==c~пdؙ1Ƀd~d}t =0u=8u=4udD c8 fEu"R<$}E Em$Zm1Ҁ}t u8 l9p}1=@du,9<v=< ~ lp=uL~VRQSj h EP{6VRSj h EPaEPj=uu+=~fڅ} +519}CM~h/6kj.iC9|6؍e[^_Í6U\WVSuU U=jO=u#tPfh hȓ Q EvF==t =dw=j=t =TT=G=uVuEPu(0ЍXEH$t   d  ܮ `  x @ t    @ t t =u'V2 =@du* Ph< rPvjPVh$_v=O=tjPVh$s-jPVh#v=C }u/Puj5[PhE rv=jPVh2$E $    H X    jZ=uAL=8 }U Um$XmPPLPRhX ]qN~ h/ghs g=jZfv=uhy p N~ h/gh dv=uh pXN~ h/@gh  v=uh ap==h/f=@duh =@du h fhf=t hehe=$t heh$e$h XfOv N~ h/4fh ke6=uVh Povh/eh =h/eh v=uh n==h/e=@duh =@du h dhd=t hdh}d=$t hgdh$Zd$h/dh .dh/dh dV6=uh m N~ h/dh tvh g6=g}Y]}Duj KvM~h/2d}Zu =EPbv=tjh? /m==lC =lu/P5lhB l C =D u/P5D hW l5DPRhd lhy l vh/Jch <I4=uVh| hlvh/cj?aV=uVh 4lvh/bV=M~h/bVav=h/bVaov=tcM~h/KbVBG9~E9|}t .B.B]Vh(DP } uE /E 8t#Pjs}jlSjst}jl=$~= tSu hjjeS=u jt}j2l=$= ju vVu hR-5j sivSu h,R 5jrEvVSu h R5jr 6uh4R5jr}jik=$~= tj5hjHd1e[^_UWVS]==uhtdt,uShW55jq}P66uho55jq5jqƍ6jjT619u}61ۍ639E~P/ 9u~P3U P/uPhWMW5C~h5t35jqHF9uf19u}1ۍ639E~P/ 9u~P3U P/uPhWW5C~h5t35j[pF9ufe[^_Í6UE=tR=u< tEtA<t=<t9%Pjq}%h/NVhDVjhÐUWVS}u 1ۃ=t^tZ9}V;C=u< tt<t<t%Pj'q}h/UhUjChe[^_ÍvUWVSEUËE<׉}~WQShhz, 6zze[^_UVS=Dtv=uh@q5h/hjf=h ƃu/>t!V5QSVhj1jh/hj(=tVh]h8]e[^ÐUVS]u Sh/hdjVh/hoj jj 5,=/Vhz=9~1jj 5,=5,=dZ)ÃPj 5,= 6j/h? `Kt j-h? Be[^ÍvUVSuU E~/~++ER$P<$}E Em$[mSh/hjVh/hjw jj 5,= ~9t*S;Ph  6h5,=s؍e[^Í6UEEUfu]6L%fEu Í6Ejh/hj=uh/hj}U Um$XmPh/hj` }U Um$XmPh/hj-}U Um$XmP,$}U Um$XmPh/hj 58 h/hj5h/hj 8 +Ph/hj5lh/h'jp 5lh/h7jV|}U Um$XmPh/hGj& }U Um$XmPh/hWj|}U Um$XmPh/hbj%|U }U Um$XmPh/hqj]fEuhE=8 }U Um$XmlPh/h}jjh/hOj* jh/hfj =t=jh/hxj5,=jh/hj$jh/hjjh/hj{ jj5,= jh8hjVjhh5hjC,=8tk=h5uYm=h5t8hh5h8t"hh5h85hD2vh85h' 65h jj5,=N5tPh=tjj5,=#hhvjj5,=hh#=tjj5,=h<jj5,=hKkjj5,= =t4h 7c6=} z&=~8="uhm*5h]SSh  hujj5,=P蛻Ph}=pt%=Huj j5,=hzj j5,=h^j j 5,=hE jj 5,= =@d%\tRh=t?jj 5,=$hjNj 5,= jj 5,=hjj 5,=h jj5,= )=Hu/Rh.Sj j5,=h>:jj5,={$hKjj5,=_hYj j5,=F hhj j5,=*hujj5,= hjj5,=hjj5,= =Huhhn5,=uh/h2j0Ph/hAj uh/hKj0ЍXUJ$P   x            4  Ljj 5,=5,=>jj 5,=5,=$ jj5,=r5,==@du7=uj j5,=ChULj j5,=-h`66=@duj j5,= hij j5,=htjj5,= 9~Vhv9vVh aHvH9(HPj5,=zVhH6jj5,=YHC 9~Vh5 6VhHأH6M Ljj 5,= =L~uh5,=mjj 5,==L~\hN5,=0;6=<jj5,=hPPh 5,==<jj5,=& =Hu|=~s=t,jj5,=4hhh*6jj5,=4hhh_5,=A=p=H=dt3=t*jj5,=ch 5,=lع9u <9t>jj5,= 5<Sh<5,==@duD=Hu C6@9t.jj5,=ShH5,=-jj5,=u =@du @<Rh5,= =H1҃=dt-=tdhEPB6P9t254څRh EP~Pt+jj5,=EPh K5,=0DH89t.jj5,=dSh 5,=09=tR0YtI0Nt@Wh? ]Sjj5,=Sh  5,==0PۃL] $ 6                               | X            t         4                        TPvuh/hj5h/h.j 5h/hFjg=L8 X=@duX=@du 4 X0Zu*=8uU=0uL=4uCd7v=Lc~#LйdËXЙ61ۉ=d=cu=} d9t3R5"jj 5,=58 h5X5L5 [v5X5L5DH8 9t(jj5,=Sh.5,=>jj5,=JVh 5,=+vTPv5X5L51jj5,=h[5,=u Yjj5,= u/j>tRO#v5X5L5jj5,=n5<h 5,=DH89jj5,= Shſ5,=0Ph/hj?5h/hj( 50h/hj050h/hj54h/hj 58h/hjjj 5,=K=\tjd558 hо5,=jj 5,=5,=5,=0G$    8 T |   P 8  Tjj5,=h(jj5,=uh4vjj5,=YhCvjj5,==hXvjj5,=! q5Tfvjj5,= >t%Vhe]SSh 臽Pvhqr;6jj5,=hyvjjvjj5,=h vjj 5,=e5Dh5,==tbjj5,=/5,==t<5D5T5Phjh hj=@d uhxhi P55O}>jh h=j=@d uhLhL =H_vu_=tV=uMj讼t?jh hkj=@d uhzNhzR=H_st=H_vt=H_rt =H_xu0=t =t = t =H_t5H_h hj15H_h hjQH_t[^_ÐU1ҍvPkoB~196R$ 60 L h       , H ` x    PkoPkooPk o" SPkP oe 7Pk o Pk o Pk o !Pk;!oZ!Pk!o!Pk!o!Pk#"oB"vPkh"o"^Pk"o"FPk"o".Pk#o0#PkP#op#B9ÍvU1vkPЃJU$ 6< \ \ \ \ \ \ \ L \ \ \ \ \ \ \ \ \ l |       ( \ D T \ p \     \  \ \  \ \ \ \ \ \ \   0 L \ x       < X \ t     \    4 L m#m# m$m1$mh$o$m$o$m$m%o4%mc%o%kl6m%Om%?m&o&/mC&mv&o&m&ok6m&m&m 'mQ'mm'm'om'o'_m'o'Ckm(m1( mG(o](kmm(km(o%6km(m(m%o(okm)Hm')oW)7mj)o)km)m)o)m*km5*kmE*oR*6mr*vvm*o*fm*Nvkm*3m*o+&m2+vmo@tÐU(WVS1= vM@11ۀ>t:6Ҋ+F<=t<:uƄ+6+vC>uȃƄ+P5PhYƒg@ u +u } u #} t @ u +tދM161@t@u$      1  P | P      \ 1<DPt+>tL6< [ۍDF>u)vP5pVhÃ~=u ~~=ujhL+mS$P5pVh褀Å0vShV} tVh4N_P5pVhHÅY(1v1ۀ>t<7\F>u,ShV} tVh8ShV| tVh@ShV| tVh<njhVVhPavP5pVhHÅY\1vP5pVhÅ)HvShV | tVhDHvShV{ tVht1ۍ6, vh>,6u/=~&=@d uhO,6hO,65h hz,j1h h,j =uh,//6yt$=@d uh+h+6p (=(~ p8-u&=@d uhF/6hF/6pjj j0"Ã"0=@d uh,/1^h,/O6\v }(P`jv vxt$=@d uh+=jh+[6p (=(~ p8-u&=@d uha/$6ha/6p%Xwh$h                 6=@d uhp/Mzhp/k6vdvdovSvyt$=@d uh+h+6p (=(~p8-=@d u h/Oh/rxt=@d u h/Kh/>p (=(~ p8-u*=@d u h/ h/Ép0h_Dh/p0t1[^_ÐUh<=$ ~#<=$ t<Ph<Ívh<USv5Lh.0h<5 hp.x}t?e7 :t=uh<'Dxtt1똻두Gt|~$ ]ÍvUS=th5|Yϋ6"v|Y|Y8t 68:t@8u5Lh|5|Yh=)Ã|c=uD5|hhI=5|Y蹒L5|Y]P h+=1]ÐUS=th5|Y6"v|Y|Y8t 68:t@8u5Lh|5|Yh=B(Ã|_=u@5|hn=5|Yy5|Y\P7hO=:1]ÐUWVS]EEjShv=j#uU 60ЍpuM vFP迋EtSu載]S 0Ѓ;{tBP耋EYSuyU :t 2wUM .vE11;9};\uE6;{u}uE}u|C]]뼍v;}us}umMu`CWuh=jM <t 4ܑFP谊U tuP誈GC; t]K6FCDECF56M9tK9}~FU <t 4nFPBM tuPj誤 $L v 0 8  8   0 0      0 \        ,     H 0 ==xDž><6E26DžDž|EEhDvt5Lh|h.0h>z|}h>B h<t 4I=|0҉H=AQ)1҃uLRh|h.0?u>R|}&=K?u5?Rh^?*vh<t 4葌5|É|0҉߈҉H%AQ`5LPj hb?hd?O65Ljh|h.0hr?:|}^h? vh<t 4轋0ҋ=|=t/=tLu=u Lu h?hD.5Lh|h.0h?4|}h?Qv5|q‰|h< t 4 0ҋ=|҉`R覃‹h6=t;=tLu)=u Luh?U/vhD*5Lh|h.0h@0|} 5|‰|h<t 40ҋ=|҉`R贂‹hSh.0h)@j讟wjh|h.0h?@|}hR@I5|É|0҉߈҉Hh< t 4 @Ph 5|RhD5LPj hb?hb@|WP5Lh.0hs@5@h!|}h@mv|hLvSh.0h@j jh|h.0h@|}K|.05|"É|0҉߈҉HDž|19~0|6|<\u|vt|@|9؋|9NhD<t4#h 0=|H@P‹h5|R}uhDq5LhAh.05`h$4‰|hT.6$5LhAh.05h‰|Rh.0h(Aj |hDvt45LPj h9Ah>A|5 vDžhDmd5LPh|h.0hWA|}hA+6Sh<t 4$=||;0҉߈҉`R}h5|R{hD x54lhA 5,lh.0hAj}=Ht%}~A}uARhA } t~!=xu}~h!BUv.0.0|Y|Y|Džt,ltA t650l5|Yz4lt}:0lPP*NgBtXBRhvBNDž| 50l5|YCz*6|.0Džp65,lhB j5|hBj ph.0hBjH0L\ }UHЍ(|~ DHH(| ~ D HH(|~T=t HH(|~ D0HH(|~ DLHH(|~ D\HH(|~ DHH(| ~ D HH(|$~ D$5Hh.0hBjǖ}~d~  ~" <6|~+ }~ 5h.0hBj}~Pj5|hBj5|9|jPhBj|$8uhC$~}}~hCCa}M؉d0ҋdʉ֍~d{JƒujFPxÃtXdSv|;/t /XD;SJ|S~|}dhtCTdjhxH}]u.0;uhCt vSjh| ttL`ZDž|(|PPS苵S5`Z{uhC[ Sh|衕}~$=t= uhC% vt~3tthD v=Hth`D }~"=Ht=HthDj <T}~$= t =uhD0 vttHHwhE _ p5l|YHW0|YqjRhBEjĒ5LPh|h.0hNE|} .|qHWӡ||qt6|Y(9qR q||quˡHP4DWhBEj=uHK5`Zh(SI`ZHK0҉։`T2` "ShHKSvhEhHKDvvhE:6<~E8t*E#T~EWFtt Fjhh.0R|^ <~T~huF 1<~ 6T~VFuFRhFj}=HtFuFRhFvth.0hFj=d|.0lu |.0=|u |.0|8u|=|u |.0u|8uhF0=|H^~.'GuGRh;GXDž|65|hdLp|Yu0jRhIGj5jhdhWGj"L36j5hfGjjhdhuGj }ptyE Džtp|Y G GB GJ|Y|=u*.0v|Y8tE}p=usuj 4juhGj5hGDž|MuhOj5hGj賍Džtptu|Y8uk=ub=uY=dt@hpdl$LhG _pllt7HW.0l=t?|.0.0.0|Ywv=uk=Lu6=u-5|5|Y@m|YjPhGj3hHKh5C lc=u .08uO}~I}tC0=|YK()Pu|YPq|Y }~ l5lh.0hGjx=lt=thH5tt[:tP`ZxDž|(|PxPR[55`Zruh#H&j5hhHj܊55j5hHj踊$j5hHj衊= t5 t 0=H~D@P5m‰ t5R*k  v.0th.0hHjt~+tthHvt v5h.0hHj諉L$~ L5Lh.0hHjtL~jHhjo D~j@hLo }~juh&4o }~juh9o ,~jhL( l~ l4~ 4}~'EԣPh.0h Ij蕈}~>ẸPh.0hIjh5h.0h IjQ \~*jh.0h&Ij}~Ox}u x30}Pj‰xt uRh=Lt%Hw=t1Xjjuh4IZhnIPs}~t~lt{yvh=Nh%>BhP>6h>*h@hAhzE|YDž|3v=t\t Dž|5h.0hIjq1ۃ6<:t 4:SpC~⋅|@[^_ÐUWVS=u6C~1ېhC~=t5o1ۍUЍ6DC~}uE]Sh5Lj5h.0h.0h<jEPW#(jjjjjh.0h.0h.0jS3#(uАEPk#Wh.0hIj#}(t Z5 khIB6=,l;1:t=ut 8lT4lSh.0hIj訄t t6DGv<5Lh|h.0hIVǃ}hJ6t5||0=|Ѝx<0t 40mGPf35|PdD3v54lhA1v5,lh.0h*Jj蕃=,lt55,lhBUh=>}tjhu 1ۍ6C~=t5m}%P\}qW5hAJj΂1ۃhC~1ۍuЍv<0t 40lC~%\[^_Í6U WVSDžDž}|t.}t%uhB66DŽ5Lh|h.0h>|G5|5|Yb5|Y|PPA~u } uDž1<F~}|uw=~hh]J/19~&6PhF9jPI}19196=tt+4,h%jj4t7jP褁ڃ9~vDB9vC9cF9F19~"tiF9ދ[^_ÐU0WVS]Sh.0hJjw1҃tWt ytuS $: v; =; =; : =; : > : ; =t hJ5Xjq}uhJ5kc <u4t2Cw{jTh.0hJj~Sh.0hJjv~ 5Lh.0hJj\~SVSh.0hJjB~$5Lh.0hJj(~JC˃vEtt gtuS?xJvQu^‰t[J蝔QJ =Ht hJJv‰tJjju hKIh.0h.0h.0jL6S=C蟾96ku…IjhNKD5Lh9hQK5$h‰teIS‰xPItt 1҉xttIt=4~"ttt94ޡ4x=t}xutj蝓x1ۍ6utjP}utjPu}C~xt t xt@to=dt>5dt46>t 6e~t ve^ Vweރuhdhx=x<v*u/jh|h.0h_K‰tG1G6tu SiGug=t.=tu=u u htKG=B=u =jBpGvtuG=t.=tu=u u hKFSN#F\ucF5Lh*:hK5h(tu hKAF=t/<6‰x3F=t'uFj{#t…tDt=fhK=W5tx:;t9uSd@Evhus5Lh|h.0hL‰t{E5|Ãu.0;tSh^?j Shq^;=:6t7t Cvzua=t0=t@u=u @u h7LD6 k:.uzu SW@D6GsDž1ۍvDŽC~jh|h.0hWLx}*hbLHDvPht5|‰x /D~ DžDžv9@P5thxLS_jh|h.0S+ } tf5|y‰|uֿLt"5|WWxKjh|h.0hL1‰xCtP}4hLNjVhL6Dž Hv9|8StPhLVt^V|C9}ϻ9|$6t_C9}ދABSt(tCv oS[YtPh.0hLju(tSt q !=t =   = =t'= 輟 = 5tt 6us=t:=tu=ut = t hL,Av=<=u =z<܀AvtuC=t.=tu=u u hM@S}@[@<u m=[@<)5|蕓 ?2/=u hM>x=~Ssr6 xI<;sL>D;D>x=x9=5Lh.0h75hst}=4hM8>v5Lh|h.0hM2‰x>[@t5|5t1 'v&6 tt _65Lh|h.0 tu N6!NR‰t{=5|O‰| uC=$t"=(t=uRh<;5|h^?|;vu5|h<\j6=T8=u =>8=t(j5|jhBN5`ZX5`Z?vj5|jhBNh <SG;Du 袓z<jh|h.0hKN]‰tG<=7=u =7j5|h]Njo5||jPhfNjlo$,jtx|€8ыt< \ut]u S蓇G:6=t.=tPu=u Pu h?95Lhxh|h.0hNt}/hN96=xt hA95|5|YN|.05Lh|h.0hN‰ti9W ‰tT95|Y5|r?.Zu *9uu 93u+ ‰t8Ph^?F7t 5Lhtj h.0hN~‰x}8Xt5Lh|h.0hN‰xp85|5|YLM‰xG8j+3|Y:tRh^?vj5tjOuF=Ht hO7v‰t7讬a7 u{=Ht hFO7‰t7jjZu hKf7h.0h.0h.0jF@=6Hu |27 tt ntuF=y =t(c =u (M huO6vVujV ,66kj5LhhR4hO5hptPh.0hOji,=t hxPh.0hOji x߃$HP vP P P P P P P P P P P P P P P P P P P P P P P P P P P tMt*At5t.)t 5khOt5t)H5v[uhmQ615^uhl=65+uc‰t55t诊t l=t8/t itu~5Lh|h.0hOx}hOV4j25|hPVME‰t ?4|PVShPV衦%4-tCvu S蕮4u w36t8t d58hO5`ZODž 5Lhtj 5`ZhPVx  =x5 k} h5P:3P@ jj jWHƃjj jPrHjj jWTHvV9} Q)~ tx6x<rt4rOxrx=x_~ƒdxv5Lh|h.0hPzƃ1j5|hPjee|:{uB1ɐBBA:uI~.|<}tI~|:t BB:u0=|PG¡xr>15|x4rEtFx=x_16x<rt4rNxrx=x_~ƒ=xvx<rtR4rhPj0dx=x_~5Lh|h.0hP‰xp05|D |0҉ψщQF‰ru hP0v5|5rDrtdu00hr5tn#0/6j5|h Qj4c5|5t-<$=#謾=#=#u hQdu h'Q8#h:Q#6.uG5Lh|h.0hOqt}$hO.6=6ug5Lh.0hKQ5hHtu hWQ.=ts$5t‰tq. vuHO‰tL.=t=t5Xj,`vhnQ.6)ug5Lh|h.0hQ‰t-=:)=u =$)5||-6u =Ht hQ~-SR-uh:n-uj(\-vu[=Ht hQ--5Lh.0hR5DhTtu h"R,5t=,us=t:=t$u=u$t = t hUR,v=(=u =',vu8g‰td,j*ttlt teuD= =t =u h|R+|tt fDžDž|tuu5Lh=0hR5hl‰tw+=tt5tSm]+u hR7+6=Ht'hR"+=Htu hS+eu=t h6S*Cw=xt haS*eu=Ht=Ht hS*vteu= t =u hD*6.0.0xu"5Lh|h.0h=6v5Lhxh|h.0HH=wSRt=t}c=t=dtAhpdllu LsOvhS)6uxj5|h Tj ]|:{u)0ЍH~| }u D |j5|h!Tj\|8u hC)6=xtHHw hE(6pl5|5|YM=j5|YhGjE\|=huHK5`Zh(5|5`Z5|0HK҉ЍD = VhHK@hEhHK@)hEhHKh5|O fuX=xt h7T'=Ht hhT'5LPj h.0hT‰t'|uHj5ɫ5LPhT5hd‰tw'=ttlt|tt CW5xh.0hTjZjhh.0 U=xtTR‰t &=xtW:tL`Zt(htPR}{55`ZAu h#H&vj5h5UjZuA=T&=xt hMUF&ljh.0h}UjY5 |YjPhUjYj5hUjwY$v=Ht hU%= t =u hU%5xh.0hUj%Yd5Lh|h.0hV‰t v%0=|u hVC%65|hd90dH^~ h+V %6|YjPhDVjXjhdhMVjlXL fu lu L|t"spl&6j:Ã=hthX h=dud|Y0щHtGW:‰|5|YR8|{0щHt C?6t@P(:|u hQV#655|8|CC hhyVg#6hV[#6et ~!ft6 =6Ptmu"HHw hE"SV"uK=Ht hV"‰t"x=&ul5Lh6hV5(htu hVN"=t;5txxkhW"uo5Lh.0h5W5Hh,;tu h?W!=tj5twxhW!v=t:=u$=t u=u  u heW\!v5Lh|h.0hWV‰t@!==u =}5|tPh.0hWjqTP(t `=#=u = hhW5`Zg<5Lh|h.05`Z‰tj =thW论=u hX* 5|-( v uC5Lh:h.05|h3‰t5t)!=t.=t0u=u 0u h9X5Lh|h.0hYX覽‰tt }j|.0M‰tJ|8u 5%v5|5hI=5|Y:5|Ye"u[5Lh<hXjh‰t‰x5tL 6CЃL5Lhtj hb?hN@‰xn5Lh|h.0hXW‰xA5|‰|:tRh^?r1u 豰5Lh.0hXjmQ=LLHjhX4żJ*7 tijhXLH4żJ7 tFjhXLH4żJ6 t#jhXLH4żJ6 u~jLH4żJhXjPjU衋TO5Lh.0hXjP$=L~, LI<żJt[@<L<t40:j3¡Lt5thORP8 謫5Lh.0hYjO=tY6Nu#:‰x7j[+6$=<~ h Yx|hxh|h,Yp5LSjhth|h.0h5YĹx(}hKY=tt heYz5|5|Y/0=|YHt|YC5Lh|h.0hYB‰x,|:(+tPRS45`Zh(5|Y+`Z|PhYq%qx vx0qhq<x=x ~jjhS5|Y表pvWuO555jjj, x}g55OvuP jjj,x}l5x6yuO555jjj,`x}55룍v%DžDžDžSh5Lj5,h.0h.0h=jdPv(@Vj5Ljjh.0h.0hYjSI(jj5Ljjh.0h.0h=jV!(6dPX‰t=,lת€:t=u 8lJ4l tW t5 =&Džh>DžqDžDžWvDžDž;v=,lt =,l[h(50l5|YP1|Y|‰x ==u ==4lt hYUt t t.5||8u hC6lP5|‰6&t #u5$ }5=t/=t4u=u 4u hYVSj5Ljjh.0h.0hZjW(jh5Lj5 h.0h.0h1jSq(1PtPh.0hZjUI5,lh.0h)Zj>I$54lh.0h?Zj$I=t =,lu 54lv=,ltr1jt 50l5|Y)4lxTv5Lhxh|h.0hWZ t} h`Z65|5|Yc)=xt hZ‰xV5|YhZj0HjV5|Y69,K5Lhxh|h.0hZXt}G hZB=xt hZ.5|5|Y(5Lh.0hZ5 hPCƃ5Lh.0hZ5 hPÃ5Lh|hZhZg‰t=t~ h[h(5|5`Z-m‰x gSV5`Z5|YJ?u2‰x/5|5 5h%[jh>[`8t h@[I:tRht[0h[#6u$‰xhV'=t.=t0u=u 0u h[E5Lh|h.0h[B‰x,=th[pt vh[V'ƒu0H5|RhI=5|Y-5|Y mvAtat 5Lh.0h[5ht}Ih[诫:65Lh|h.0ha1:‰x$5||=tt$pu vu u u u u p u u xxxxx t=tu5|h<hx<ʩ 5|h<謪Xn=tuh>[hx<茩vh>[r5x9~FAu5|5x診65|5xGt=t}h[vth \=tCw,‰t|s%$6v=t.=tu=u u h#\5Lh|h.0hK\z‰t}hb\5|5|YG#|Y|‰t5|芇‰|j5PRj‰t=h|\蹨w=t.=t u=u  u h\ 5Lh|h.0h\&‰t 5|5|YN"|Y|‰t 5|葆‰|j5PRjttz x5Lh.0h\jh( ‰tA 5Lh.0h\5 hX T‰x ‰l =t5x5tb 5x5th\0{u;‰l  x9 v}ue ~5Lh|h.0h]E‰x/ |Y2]6]B5|5|YX$jPj@5|Y6tB?~J(pp*gˆt.Ph.0h:]j?B Ph.0h:]j> 6us5Lh|h.0hH]E‰x/ j5|9|Ph^?i5|y] % 6=ؐuGh] ‰|thRhؐ:$ ה=ؐu h]z h(hX5`Z$`Zƀ(5Lhxh|5`Zh]t }?u.5|C}(5|h]pt 6=ttK鐃=tt?h(5|5`Zq#`Zƀ(5`ZthZ `Z‰l =th]v`Z:thXhRW X|Y|t=ؔtjjjhؔh<h(h؝5`Z!`Zƀ(5Lh|h؝hP^‰th5|h؝}!׭|Y|t =XtjjjhXh<;t=tth؝hX5`Z[# 6h؝hXhI=5`Z:#5`ZhXhI=5|#诖5| tPj ‰thT^Qum^Rht^4=t&=t5h^h>[ um^Rh^=t=t5h^àh^趠h^謠 v05Lh|h>_h@_*ƒ5|5|Yx0=|эQ|Y|;{u|}u#D|Q|*|D~)|<*u|*u J~ |< *t=(kt =4ku hw_Y5|ƒt,j Rh_5k!h$-5|h_t6u G6u8‰t_=t_Rh_3u$‰tuw‰tt,6u$S‰tPDu jq-u j]u jIu j5u j!u j u ju ju ju jyu jeu j Qu j=u jm)u jYu jEu j1u ju jM25Lh.0h.05h̸‰tt5Lh.0h_5hH肸‰t<5Lh.0h_5 hPO‰x} ‰ltxLv5Lh.0h `5 hP‰t5Lh.0h!`5hH起‰x} jX‰lUtxp/6u\5Lhtj h=`h?`Ț‰x‰l5t v5Lh|h4h\`覲‰t5|h`5`ZIj5`Zh`j3=t h`?65`Z)?6t0v)hPh=h%>fvS[^_U(VS=,tjh ah ajL3v5u a;u ajhah"aj 3VSh2aj2t Sj 豹PEEEEEEEEEEPjSj SPh ah=aj2 e[^ÐU =,tjh ahJajK2Ðjh ah`aj52= tj BPh ahlaj2Í6US]Ph ahzaj15 h ahaj1   =@ >;@  @ @ ƀ 5@ h haj1@6= t=@ t5@ h j @   tu<= t=@ ~@ HPh j 藩@  5= 1 $ v \ P  ԋ   @   jh haj0[u Pt<wg 5@ h hajB0_x=kjh ahaj0 ?/@  j<>=$i@  jhaS u qjhaS uOh 5@ _u= tk=@ ~b@ HPh j 5@ h ha6= t3=@ ~*@ HPh j צ5@ h haj<.@  ^6] Nu :=- 9 Jv\ = t6=@ ~-@ HPh j 5@ h hbj}-@  =Ph ahbjG-J u =t_ @9 ~+J  J  & J 1]ÍvU1҃= ~5 5 A¡  ÍvUU = t = uB5 h ah.bj3,5 5 Έ¡  1U= z  j~ƒ|l ps~,+ 9~5Pss~ v|  Í6UVS1 SPh ahBbj<+= =~ 55D j ;5<h ahLbj*=<uKiu 6D  e[^UWVSh<xh <tjh+@  f~f~{=u h`b=}=u=u hbv=t=u=t hbv= u7h u hbVv  = u7ha u hcv  =D u#h! D u h1cv= u#h u hdcvD =5h ahcj(5 h ahcj( 5 h ahcj(5h ahcju( j5hcj^(=~pRh ahdj9(=55h ah0dj(jhhAdj' j=t  vRhh:};hhQd5 5 {jhhfdj'1= @u = 0=#=t"=t hh{d3hhd&hhd=~5hd=(tU=t6dR54@%Phd蝍he蓍h9e艍 hbez=t3hHOhe_e=teRhe>=t he(h < P臁} he65h ahej&5jh ahej% 5h ahfj%55Vƒ=Rh ah(fj%GjkEj=t 6Rhhn8$}'hh5f5  5  6= @55V}hLf5h ahwfj$5Ph ahfj$ ==P蔅Sh ahfj$~LuGSh ahfjy$`hfFhf 5 5aj6=5_f  59=5vf ύvh  55p5 hphj`$ = 5t= t "6=   5K~v9~C=~55P9= 55Nv=ts}o =5t555=5t55p5=5t 55O5RbjDK vjƒ~yC55PtA= u~D = u85< u| t25< u| t 5< t< t kC5S55h1jRj55h$ T5@O0$ Ѓ~$  w ƀ$ Hyt42== 8 sOhop55O= =6jC55P@5< u| t5< u| t~ 5=  =P j2OÃs j hGUX h]55tHha55Yhe55>hi55#t85lpBtBfxfB  r6hz55t%=5}f  4h55t-5BB h55Tt%=5f h55t95BBfċfB  gvhƋ55t-5ɋ͋BыBfՋfB h׋55t%=5ڋf h55Ht%=5f h55 t%=5 n6h.55t%=51 3vhE55=5Hf h[55Thr559= ' 56 H$ 6`   ,  (  2  , 0  ,   ,   h55`h55}h55bh55G?h55,$hmn55hÌ55mh͌55h֌55uh55Zh55Mh55jh55Oh554/h55h55h55h55h,55h355 5hh6+vjE$%PvPhph<j=Au  5=B  5v55Ju 5 uv55Lu 5 Ev55Nt55Pu 5 hR55Bt 5 (6h55h`n55 h[55hmn556h55ha55hi55hhqz6h|55Dh55)h55 6hi55xh55 5vh55t 56h55|h55ah55Fh55+hč55hhՍ55Mh552h55h55lh55 5 kh 55Th(559h55h55h055 5 h;55@h55uehF55}hq55dt 5 Jh554t 5 hR55t 5 h^55t 5 hl55t 5 hs55to 5`65 h{I 5 2uhphjtj= 5u j= 5u#h9jhphÎj.lh8jhphЎj = tj 5j5PHwB|u hߎH= == t-tP= 5u Ph*v=$ t+h$ = 5u Ph,H $v= 5u PhDG5 =5t555=5t555=5t 5551= 5u e[^_UjhphVjr5 ÐU4WVSUv}uEE  }<=~  = } 5 hF =  1҃= "t = 8u 1҃= t = 4u 1ҡ փv-= ,t$= t= .t= 0t = 9u   /uh͏E kvj5 hjh5uVh3{E $5hhphj=5ukhp5ut)8u _8uA9u =} }u%= +$5 <= s=f}uhd@'v5 } ~Rh ;@ }  }=   =tiSPhh1? EOSPhhS? =~5hj?6hx?=  =u*~&9=~5hu?WhՑj?}uRhL?=~5h-0?vh9?hB?л Qhhj5hphj hH j謽‰hX h h jh_5j|=  t = u v1e[^_Í6Ujh蕺UWVSt hop6= u+5%0 001ۡ5 C~5ƀjhphj=054pÃ|ShphjtÃ= t P31ɡ5TA~5S55hjj؃ t( TtF50t 4t>=8t5 t u} 0g6= u( 5<DBtDBu4=8t5 t u 0= ~= qj 1b655u045505ƿɒtƿ͒u 5555PhђR65ƿےtƿߒu 5555PhjQ0I50hphj%e[^_ÐUjhphjjhphjÐUVSu] Vhph%j0548=5uBh苶5u r6hhph3jr5jhphHjRh h` hP VhZ$jhphej"y0e[^ÐUWVS155hphj=5t26jm$EShphjS} uЃ= 5MM1ۍ6D+C~j$EShphjlS><DXMM tQvIj$E%Phphj} t M} ;CEP} uD+j55hjSuhȓjs ~ D.D.NxT.<DPtFMFjQhٓjVEPhju0UH jj ju;Á2$ v$  4 d     D     T  \  P   X   0   X   ( X   4   `   ) h    (    L      H     4 H    h      0   P            t                                                                        5= t hu5 5 =  h A5 = t h1%5 5 \h6= /u3jj j5 1u=  hK v=  h] = t ho4 5 = /u+jj j5 v)u= thK6= t hz14 5 h= 2uhXLh` 6= u= )hK h6= u/= t h3 5 = = %t = u h@8%v= t5j5p } vU= v0= uC86 t6jhhj,=s4jhj {4t s4 jhphj=t<0HPh} 5x5p5lD %DZƅ|>4e[^_UDÐUWVSK@0@Ѝx~ 8=t=tWShaj蜉uIj貏D==jhXhtjTvƅ1vD(@~5tlUp=xh h h4 545hL2=tG=tjVhjш=t#=t5DhXhj襈i[^_Í6UWVS0@HE=t=tPh@hjL@̘uWj%Pm=<t hИ==jhИJ@֘t,@ܘt@ߘu:=<t h^=Njhα=}@=@tP'C;uuh@[=<t=th@u=t+=t"0@HPh@9=Hj %P=05t[=5u=8t =8u(j &=5t38Hw(=8uj vjA%P=t=tj %P(e[^_U@5ÐUS@56[h hP h4 jhL/th,ȡ@5]Í6USE@=t =tjhX5,5j膅=} !j5hhi}&hhh@蒐h@Ev1= u=u=t<=~<[@<u <[@<u P<=<t7=thhs65hh%W 1=t=t =5t=u=t8t05@@;tP{Ph@ C;u=t=tjh@hNj55}h^ jj{@8 t(<v@DB t@@8uD;@@8-$o>@@8-1=Dt@8tq<fBf% @fu&<@8tEfBf% @ft@€8t# <6DA t@@:u@8tu]@8Sj;=<t h= =t=tjhXhj9J6Sj=<t h =t=tjhXhƙj1]ÍvUVS=u=<u =05kÅ~g6jƃ=05t_}tFuh-h1jNjhPhNj; uhdhNj$v$E5Phhfj9]tg]jEPjj5 t$5<oPhj踠E5J6uhhj蘠uhhuhhڛjt5v1]ÐU S]=IH:=-EEPEPjj5菈t5<)oPh>}tFuh-hj֟jhPh7jß uhdh7j謟v$E5PhhMj膟9]tg]jEPjj5蓄t$5<}nPhmj@E5J6uhhj uhhuhhj5v1]ÐU S]= H=EEPEPj j5t5<mPh>}tBuh-hj^jhPh(jK uhCh(j4~69]tS]jEPj j5Gt$5<1mPhQjE566uhhxuhhjĝ5v1]ÐU S]= H=EEPEPjj5߅t5<ylPh>}tBuh-hߝj&jhPhj uhhj~69]tS]jEPjj5t$5<kPh$j輜E566uhhIuhhfj茜5v1]ÐUWVSDž|Džpuhhj@T5}R jduh5,jh5hj5=5t ;:t C;u;:uC6jShjț<DPt*|jj jS}%vhԞS赃|=|u0߹u|q=|t}؞߹ua|ztRfB%Phޞhx<hhx<|f@%PhhIjϚ=|u3Shchx<5<Shj蠚<55hhjy5Phh̟j` =5tF5|f@%9t+jhhj&55555hhj=5jh}jhh)jșf=5t55~ 6|f@fT5jhh>jijjj|5}"hY5<hhjRv<jhhjj|Pjj55/~ƃ$Vhhj|f@%Phjh55}}E<55耂5f5<Shh٠jhhjUh'j55~}G<55 5f5<Shhvjhh,jݗ|f@f5|f@%PhBDžxDžt}}E؍x vEtuhhyjK}pu61 󫡤5EDždtQjjVh[zƒ~ 5Elt Džddptpu }hh55z fj|Wj j5{5555hhjL(55Z55hhj'555555hhӡj,5555E|55t8 |fIhԞh}ƒ9ru=5 t 50} 2VVhhjd} ?}5||PhhT5}=H5 = uhh <xjjh.x jhhjה= uh>h <[xE*jN 1@Pzu0҉hQ)PhDu{u0҉hQ)PSuz$= uG=u>S0hF '= uh_= u h>=H5t =jOhT5uy0ۋu҉hQ)PhDu1zf Whhu҉hDP{ = u3f%PhT5hk = u h <v1M6<55|5f5<ShhjڒX[^_Í6Uhh5{ |jjhu1UWVSDž0Dž<Dž(uhhjFT5}^jduh52xjh5hj E8*ujuu P~Dž45=5t48:t@48u鋅48:&jh5hj蟑4@48:u @448/u64@48/t0ҋ4щJ4|/uDjh5hjj4hڢj hԞh5-y,ujjdh5h襓L444;tv48@t@48u鋅48@u~jhhj4@4;tv;:t C;u;:uCjVhjAjSh.j2 j@Vh6v4 v4j4hHjjWhTj 48t48:t@48u鋅48:u>jWh`j諏4@4jPhsj茏 jO4XvhԞWwt4vjjh5hujdh؞h5Eu jOh5@V/ujOW]S#ujdSh5u$jVhjjShj0ҿ5щJ54 c)PV4t jh5hj蒎 Dž4jh5hjoj4hȣj[4 <DPt/E,jj j4pƒІ%E6hԞ48v,,uZ4uE,Eq,u*4hhx<5<hhjO4hs/jhhjl=5u[,f@Ёt"t1qt&65"55 5,؞4un,xt_f@%$Phޞhx<hhx<,f@%$PhhIjsjEP9pjhh0jRh5h <hi(ujhhPj袅;uajhhmj肅ulÃu;tjShT5nkg5 T5=T5u5=5tcjOSu=k}0щ$Q)PhDuk}0щ$Q)P4uhk$= u`;tE=u<4Sh &= u3h_= u#h>]= u h <hukPhhT5l} c=5jhhj XhY5<hhEt5P5<hZ5<hhj轃h 6<5wm<Shhjq55hh¦jUjuhҦjDE 8}1[^_ÐUS15hhߦj =u1lv=~jh5là jhhj趂d8T55t8؋]Í6U1ÐUjhhjjjhmeUÍvUWVSu} =ujhhj(+19}"6j%} } v;C9|؍e[^_Í6UÍ6Ujhh3jʁÍvUEPÐUuÍvUS==5uv5ÅKji=uAh08 5h*: u6u ÉK}:Å~.ShhOj6j~Ku1]U`VSDžjjjdƃ fDžfDžhdzejPVbÃuPPVhj V/jt7hgPhhh5xhjhh5hqj16DžhV1hjVhjVgÃCPfPhhh5gjhh5hqj {jC8WPfPhVg=5t&55Vfu55hh5`jVhj C{u[^ÐU =|5t1Ð=5u=<tjhḩj~EEEsEsffEf fEfEfEj EP}Í6U(WVS15hhj,~5 hhj~ =| = }ˌ5hh j}5 hhj} !L5jƅh0w_jSh5j}u0ЍxڊBt 6BAuGPPvShIhYj.}=t0Phvt+GPPShbhYj| 6jShshYj|ƅ=p8t*p88tOjPPbƅ /hB^tjPPlb vƅ0ЍXu.19}(*<DHt0=*B9|SPShhYj{>~3PhS d0PSÃvjhÃShhYju{jShhYjU{<j0vvw QRB` IA| tQhhyj~w A_u-=@t$@tj/hhyj;w؍e[^ÐUWVS1juhjw=8t8U<8Phhjvǃu"=8uovh{6=hɰ!;j|ÃuVF=t8}= p=8uh8h h <Y8vWh =t 6PP.ShhjuC$0D vD D D TD xD D D D D =v=tbV8ƀ0A6h, h}808Džu=8C;=t8u= u=8t hO~958uuhVf8958}5858=t hzR958%e[^_U=8t/58h0hy58h0ρ88<UVSu] =|5=50vvu?0v vw SRB6` [C53u@0v!vwSRBv` [C5u %uE0vvC؍N=u =0v vw060vvw 4 6Pw 2RhhLAZShhLAjIr =t hLA+1 N8EM]E=u =0v vw160vvw 4vPw 2RhƱhLAYShhLAjeq =t hLAGjEPu 60vvut0vvw SRB` [C5t:0v!vwSRBv` [CƂ5ut0vvw SRB` [C5t:0v%vwC@P` [Cƀ5e[^UWVS]} u=|5u =5t 160vvvVhرhܱjo}u1ƅƅ}t~VuPQ Ƅ.Ƅ.=u =X.u@u;j60vvw 4v0huB60vvw 4 0h*hLAW u;u7u60vvw 4 60hHKW0v vw/60vvw 4 PhghLAwVShhLAjn=t hLA^SP9| 6[^_USs=8jÃh =t 6PPM&ShhjUmC$L vL L L !M !M !M =tRF=t2&8ƀ06|808]ÐUVS]58=@=u} t8t tE= @uj @8h58 @S= @t?j@ @8h58= @% e[^ÍvUU r$}<5:>>~<:1۾50vvIC@P6[C=t8t>0v!vwKIAv` [C 58v0vvw KIA` [C DD20vvw KIA` [C =t8t:0v!vwSRBv` [CD60vvw SRB` [CDD1Ce[^_ÐU=;t ?;=H>tC=L>t:5P>5L>55L> OL>P>H> =h=t @h==<t B<=:t A:ÍvUWVS55hhҲjd5d8hhjmd =|5U=d8H88<88881ۍ60v#vC@P 6[Cƀ50vvw SRB` [CƂ50vvw SRB` [CƂ50vvw SRB` [CƂ50vvw KIA` [C =t8t>0v!vwSRBv` [C5:v0vvw SRB` [C550vvw KIA` [C =t8t>0v!vwSRBv` [C5:v0vvw SRB` [C55=k0v!vwSRBv` [C5tw tmVj0v1vw20v!vw 466Phj0v1vw20v!vw 466Phj0v1vw20v!vw 466PhRvj0v1vw20v!vw 466Ph'j`0vvw SRB` [C5tw tmVj0v1vw20v!vw 466Ph9j0v1vw20v!vw 466PhKj0v1vw20v!vw 466Ph]Rvj0v1vw20v!vw 466PhojR^1ҾNv}<} 60v}w ENv1B~C=8u@>A>=x8u:@ @ @ @<<<;;H>=h8tL>#6=L>t5L>XGL>P>h=:h88=5ud81=5u+5d8jhhj\ƍ6=5 t=5u jhhj\55t8hγh׳j\1=t85hhjZ\5 hhjC\ =| = }j5hhj\5 hhj[ =~p= ~g=<u^=<vUjh<0=<u,=<v#jh<=b6u,=`6v#jhiWd6=c6u,=a6v#jh4"e6=8u5=5u,=5v#jh5=5u,=5v#jh5jhh$jZ=:uM=:vDjhv}PhhDT6:jhhej9Z=:u[=:vRjh }PhhjY:jhhjY=5u(=5vjh|5=5u,=5v#jhy5=x8t5=:u,=:v#jhM;:=|8t5=b=u,=`=v#j#hd==B>u,=@>v#j'hD>=C>u,=A>v#j'hE>1ۃ/$la c c ,b c ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b ,b c c ,b ,b ,b ,b ,b ,b c ,b ,b ,b c ,b c c c ,b ,b ,b ,b ,b ,b c c 0v#vC@P 6[C50v!vwSRBv` [C5vSSh7%0vvw SRB` [CƂ50vvw SRB` [C50v!vwSRBv` [C5vSShkY0vvw SRB` [CƂ5Cth1=d8=@u,=@v#j/h@=@u,=@v#j/h@th´=} Y d85hhݴj-U5d8hhjUe[^_ÐUS]5@dShjT=@du=tSk]Í6US]=|5u =5t1 vCw 4$@EeMeM/eM`EMeMe=u =tB`Ph hLAUGRPh\hLAg;ShhLAjS=t hLAjEP]Í6ULWVS}ujhh|jRM EEj։E e]MIAM=t=cu EPKY}u#}tME6E}tZ}}u8jhhjQ=t hE\vEPv}u7EjhhĵjQ=thĵw6}uhhjWQ}u2WhhjvE,Ev&t/urE1iE_v&uWEN6&uGE>6&u7E.6&t/u"E5E~v/uEDE8tRRuE8tRRuE8tRRuE8tRRuE8tRRuE8tRRuE8tRRuE8tRRuEܺ8tRRu܋Eغ8tRRu؋EԺ8tRRuԋEк8tRRuЋE̺8tRRűEȺ8tRRuȋEĺ8tRRuu0v vw/60vvw 4 PhThLA0Ĉ|6I<^v0IPtPhhER0+vIPtPhhE"01hEhLA,FE9xuhhLAi,}uh)}uhvEKvh·hLA1,jhhLAjGG=t hLA)]M e[^_UDWVS}]t PhhʷjF=|5q=5d6j׉ƃtLvVhh۷j$v=5u jhhjtF5=t =cuPPMPEMu =u =tRw 2Rh$hLA;.VhhLAjE=t hLA C$6It1&gt =d8t x;=It&6(t Iu ƂI BIuhtPEP EhIjhIh!h8Fh8=nhI5ShIEPs:jjjj(6=Iu7^t =d8t ` ovh=ƂI8v=I6=ItˉBIujhIh)61Ҁ=IuBIBIuBIBIuBIBIuBIVh?hEj0ShUhEj0 =5t5 v50,Sh\h8Vheh8h8h8v=It =d8t!EPhIvEHP‰L>tiEPhIR2UL>DUL>DM P>H>(6=tEƀIjhIhpjj/1e[^_UlWVS=|5=5E111E9] vEU4t Vt st& EU<D)}=t0щM\ =MtM0щM\ =NtN0щM\ =t5tt50щM\ =LE,LE0щM\ vu𿅹u=t^u𿊹u(=MtM0щM\ 6u𿎹u(=NtN0щM\ 6u𿓹u=t5tt5Zu𿛹 u$=LEtLE0щM\ 6u𿦹u!=MtM0щM\ E1ɋUE<t <KCjhhj,=hs6EUD)AEE 9E7CP2Ejhhڹj-,=t hڹUBB'BBB=u =tA56hhLA'jhhLAj+=t hLAjutE@1vUBB'BE11EUE4st "Qt ?t&UE<D)}=t@UDDhR 0щM\ =Mt@UDDhMRb M0щM\ =Nt@UDDhNR N0щM\ =t5tMUDETDht5 P t50щM\ =LEUDETffT D hLE P] LE0щM\ u𿅹u8=t/UDDhR u𿊹u8=Mt/UDDhMR M`u𿎹u8=Nt/UDDhNRb Nu𿓹uH=t5t?UDETDht5 P t5vu𿛹 uP=LEtGUDETffT D hLE PLEV6u𿦹uV=MtMUDETDhM PIM0щM\ E1ɋUE<t <JCjhhj'=chT6EUD)AEE 9EkUCC=u =Ext,xu įQ56h#hLAC9}4{vURh9hEhEhLA F9|h·hLA jhhLAj&=t hLASuo|u ue[^_ÍvUWVS1=|5u=5u =:u 1k61ۃ=p8t-j5p8h<je%p88t"þvjhhEj9%uhÃt0H=~IIII;t4Ivu<DPt <v9CG;uԃ=u =tMƇIhI5p6hHhLA jhhLAjb$ =t hLADƇIGƇIGWhIbm| ve[^_ÍvUVSƅ=|5u=5u =b=u1=|8t |8,v=MtMh5h_S j5|8hfj#III#I;t6ICF;u=u =tMƆIhI56hHhLAr jhhLAj # =t hLAƆIFƆIFVhI l|[^ÐUS=:x8uIII:tIBC:uƃICƃICShI~k}^ƃI=u =tChI5l6hshLA] jhhLAj! =t hLA1]ÐUS1ۋ =|56=5)=<}1Ʌ}19 <u 9< <<ƃICƃICƃICICIuƃICICIuƃICICIuƃICICIuƃICƃICƃIC=u =t=RQhhLA jhhLAj =t hLAShIi|1v]ÐS9=9t Ѓ;u[Í6Ð Beta0314 Jan 19997.0.195C-KermitWeb http://www.columbia.edu/kermit/ or http://www.kermit-project.org/.fax +1 (212) 663 8202 or +1 (212) 662 6442, email kermit@columbia.edu,612 West 115th Street, New York NY 10025-7799, USA; phone +1 (212) 854 3703,For further information, contact the Kermit Project, Columbia University, removed, altered, or obscured.Kermit Project, Columbia University. This copyright notice must not beconcerns to their clients or customers without written permission of thedistributed with commercial products or otherwise distributed by commercialsold for profit as a software product itself, nor may it be included in orYork. The C-Kermit software may not be, in whole or in part, licensed orCopyright (C) 1985, 1999, Trustees of Columbia University in the City of New Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. OtherZMODEMYMODEM-gYMODEMXMODEM-CRCXMODEMKermitU1OS/2UOWindows-32UNOS-9UDMS-DOSU8UNIXApollo AegisN3Stratus VOSMVAmigaL3Atari STK2MVS/ROSCOEI9CICSI7MUSICI4MVS/TSOI2VM/CMSI1AOS/VSF3RT11DBRSTS/EDAVMSD7MacintoshA3Apple IIA1anonymous0isabsoluteisabsolute rcinitproto spsizinitproto spsizr*/.*.**READ.ME*read.me*.TXT*.sed*.spt*.sno*.awk*.perl*.sh*.lisp*.el*.java*.pas*.s*.F*.f*.f77*.for*.hqx*.hex*akefile*.nr*.tex*.mss*.htm*.html*.upd*.bwr*.ksc*.cpp*.w*.r*.h*.c*.txt*.lhz*.lzh*.xl**.vxd*.doc*.dll*.BMP*.bz2*.bmp*.rpm*.class*.so.**.pdf*.tiff*.tif*.jpeg*.jpg*.exe*.out*.a*.so*.o*.zip*.tar*.gif*.tgz*.Z*.gzinserverdotakeinisstelnet Internet Kermit Service ready at %s%s C-Kermit ready at %s%s %s MAIN clienthostlogin loopMAIN LOGIN tryTELOPT_SB(TELOPT_KERMIT).kermit.me_startMAIN LOGINAccess denied. Login Timeoutmain executing init filemain exits init fileInterrupt during initialization or command-line processing.C-Kermit quitting...cl_commandsckcmai got interruptmain cmdfil\%0setprefix%s %s-., Kermit versiontelnetrloginiksdhowcalledCan't initialize!ckcmai mynamerx %ssx -a %ssx %src %srbsb -a %ssb %srzsz -a %ssz %skermit -xkermit -rkermit -ir{{./.readme}{README.TXT}{READ.ME}}Can't allocate i/o buffers!main ckhostCan't open device: /dev/ttyCan't allocate packet buffers!main cmdini() donemain about to call ttopen() inservercan't initialize i/oMAINmain argc after prescan()main about to cc_executemain 2 cfilefmain argcmain zstatemain setting interrupt trapzoutbuffer mallocgetiobs okC-Kermit library, 7.0.001, 6 Jan 1999ckmatch stringckmatch patternckmatch skipUNIX Communications support, 7.0.202, 1 Jan 1999 Linux/dev/ttynoneLINESxttgwsiz LINESCOLUMNSxttgwsiz COLUMNSchars waitingle_inbufbuffer is fullle_putcharle_putsle_putstrttgwsiz TIOCGWINSZttgwsiz tt_rowsttgwsiz tt_colsttgwsiz TIOCGWINSZ 00sysinit calling priv_iniFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! sysinit jchdlr: SIG_IGNsysinit jchdlr: SIG_DFLsysinit jchdlr: othersysinit uname machinesysinit uname sysnamesysinit uname releasesysinit uname versionUSERJOBACCTPRINTERDISPLAYUNIXLOCATIONsysinit startupdirttopen telnetfdttopen entry modem ttyfd lclttopen MAXNAMLEN definedttopen BSD4 *NOT* definedttopen BSD42 *NOT* definedttopen MYREAD definedttopen netttopen got open network fdPipe errorFork errorwfdopen failurettopen net xttopen got open fdttopen fdflagttopen timottopen alarmmodemttopenttopen ttyfdttopen alarm returnttopen errnottopen EACCESS/dev/null%s is not a terminal device ttopen not a tty ttname=CTTNAM cname ttyname ctermid redirected stdinttopen setting ttyfd = 0ttopen stdio redirectedttopen ttlock failsttopen reading lockfile pidLocked by process %d %dttopen lockpid%s %sttopen tcgetattr ttold.c_lflagttopen tcgetattr ttraw.c_lflagttopen tcgetattr tttvt.c_lflagttopen O_NDELAYttopen fcntl O_NDELAYttopen fcntl failure to unset O_NDELAYCan't unset O_NDELAYttopen xlocalttopen calling carrctlttopen carrctl okttopen tcsetattrttopen ttspeedttopen *lclttopen lock filettclos ttyfdttclos netconnttclos closing netttclos ttyfd after netclosttclos about to call ttunlckWarning, problem releasing lock ttclos alarmttclos calling tthang()ttclos calling ttres()ttclos about to call close?Timed out closing device: %s ttclos timed outttclos donetthang POSIX styletthang tcsetattr failsttres tty modes restorettres errnottchkpid lock pidttchkpid my pidttchkpid kill errnottchkpid pid testremoving stale lockRemoving stale lock %s (pid %d terminated) ttchkpid unlinkttrpidttrpid zchkittrpid fdttrpid string readttrpid integer readttrpid short readttrpid pid/var/lockttlock readlinkttlock linkttlock linkdevLCK..%s%s/%sttlock link symlockttlock lock2ttlock lock2 cleared%s/LTMP.%05dttlock flfnamttlock tmpnamttlock creat failedUUCP not installed or Kermit misconfigured %10d ttlock hdb pid stringttlock found tty lockedttunlckttunlck lockfile seizedWarning - Lockfile %s seized by pid %d ttunlck unlinkWarning - Can't remove lockfile: %s ttunlck lock2 unlinkWarning - Can't remove secondary lockfile: %s ttyflow POSIX_CRTSCTS entry statustthflow offtthflow ontthflow POSIX_CRTSCTS getattr failedttpkt parityttpkt xflowttpkt speedttpkt ttpmskttpkt netconnttpkt carrierttpkt 2 stopbitsttpkt 1 stopbitttpkt 8 bits + even parityttpkt 8 bits + odd parityttpkt 8 bits + invalid parityttvt ttyfdttvt tvtflgttvt speedttvt flowttvt network connection, skipping...ttvt modes already set, skipping...ttvt using external fd, skipping...ttvt setting modes...ttvt 8 bits + even parityttvt 8 bits + odd parityttvt 8 bits + invalid parityttvt donettsspd cpsttsspd ttyfdttsspd xlocalttsspd okttsspd sttsspd failsttsspd tcgetattrttsspd tcsetattrcongspdttgspd ttyfdttgspd cfgetospeed 1 POSIXttgspd cfgetospeed 2 BSDORPOSIXttgspd codettgspd speedttpushback nttpushback my_countmygetbuf IMPROPERLY CALLED with my_countmyfillbuf readmygetbuf errnomygetbuf TCP errormygetbuf SERIAL errorSVORPOSIX myfillbuf calling read()SVORPOSIX myfillbufSVORPOSIX myfillbuf ttcarrSVORPOSIX myfillbuf errnottinl calling tn_doop()txttinl tn_doop() returnedu_start and !inserverme_start and serverttflux my_countttflui le_inbuf chttflui ttpipettflui netfluittflui ttyfdttflui POSIXPOSIX conbgt process groupPOSIX conbgt terminal process groupconbgt process group testSVR4ORPOSIX jc test...jc_POSIX_JOB_CONTROL is definedconbgt jcconbgt jcshellconbgt osigintconbgt signal testconbgt isatty testconbgt backgrdSIGHUP detectedconint arming SIGHUPconint backgrdconint jcconint background ignoring signals, jcconint foreground catching signals, jcconint SIGSTSTPconnoiin_chk entryin_chk carrier lostin_chk close-on-disconnectin_chk FIONREAD return codein_chk FIONREAD countin_chk FIONREAD errnoin_chk my_countin_chk nin_chk resultttxin MYREADttxin myread returnsttxin xttol nttol sttol dblflagttol tryttol okttol write errorttol TCP errorttol partialttoc timeoutttoc flowttoc tcflowttoc errorttinl maxttinl timottinl alarmttinl timoutttinl startttinl eolttinl unsavingttinl myread failure, nttinl myread errnottinl EINTR myread ittinl untimed network myread fails^%c... Canceled... ttinl skippingttinl lengthttinl extended lengthttinl bad seqttinl EOP lengthttinl ittinl csavedttinl removedttinl got eolttinl senses parityttinl packet beforettinl packet after ttinl gotttpushttincchttinc le_getcharttinc myreadttinc restoring oldalarmttsndb ttyfdsndbrk POSIXttwait select errnottwait OKttwait select xmsleep SELECT 1msleep SELECT 2msleep __linux__ selectgtimer%fgftimer6.A{Gzt?ztime GFTIMER gettimeofdaycongm getting modesconcb cgmfconcb backgrdconcb ttyfdconcb ttfdflgconcb isattyconcb suspendconcb cccbrk.c_flagconcb c_cc[VINTR]concb returnsconbinconres cgmfconres isatty okconres restoring tcsetattrconchk contypttinc LocalEchoInBufconinc(0) errnoconinc HORRIBLE ERRORconinc alarm setconinc(timo) nconinc(timo) errnottscarrcarrctlttgmdm K_MDMCTL definedttgmdm TIOCMGET ioctlttgmdm errnottgmdm bitssuspendpsuspend errorpsuspend ok?Sorry, device is not open ttruncmd systemttruncmd waitttruncmd wait statuspttruncmd wait pexitstat:%s%s %s UNIX File support, 7.0.140, 1 Jan 1999 Linuxrm -f cp mv pwd ls -l cat Maillpdf who /var/log/wtmpWTMP open failedWTMP write errorWTMP record OKcksyslog s1cksyslog s2cksyslog s3%s: %s %scksyslog errno/var/log/iksd.logdoiklog openxferlog open failure %s: %mdoiklog open errnoxferlog: %s open okzopeni namezopeni fpzopeni called with ZSYSFN, failing!Terminal input not allowedzopeni: attempts input from unredirected stdinrzopeni fopenzopeni fullnamefile[%d] %s: open failed (%m)file[%d] %s: open read okzopenozopeno fcb dispzopeno fcb typezopeno fcb charzopeno fcb is NULLzopeno fp[n]=stdoutwazopeno appendzopeno fullnamezopeno fopen argzopeno failed errnoappendcreatefile[%d] %s: %s failed (%m)zopeno zobufsizezopeno ZOFILE nonblockingzopeno ZOFILE unbufferedfile[%d] %s: %s okzopeno okzclosezclose zclosfzclose zclosf fp[n]zclose fclose failszclose error flushing last bufferzclose iklogopen*ikskermit_%.24s %d %s %ld %s %c %s %c %c %s %s %d %s zclose iksdmsgzclose returnszsinl zchin failzsinlzinfill kactiveZINFILL feofzinfill calling ttwaitzinfill ttwaitZINFILL freadZINFILL ferrorZINFILL errnoZINFILL count 0 EOF return -1ZINFILL count 0 not EOF return -2 zoutdump zoutcntzoutdump wrotezoutdump write errorzoutdump write returnschkfn out of range/dev/nullzgetfs readlink(lookup failed)zchki stat failszchki not regular filezchki stat ok:zchki access failed:zchki access ok:zchkozchko: Malloc error 46 zchko izchko access failed:zchko access ok:zdeletzdelet fullnamefile[] %s: delete failed (%m)file[] %s: delete oknzrtol name.%snzrtol fullnamenzrtol sizing MAXNAMLENnzrtol sizingNONAMEnzrtol new namezstrip beforezstrip after tilde-strippingzstrip afternzltor name.././nzltor fullnamenzltor name2zchdirzchdir 2zchdir 3HOME.zgtdir SVORPOSIX CWDBLzxcmdzxcmd outzxcmd pipe failure/bin/shzxcmd pidSHELLzxcmd...-czxcmd fork failurezxcmd fcntl 1 pipe flagszxcmd fcntl 2 resultzclosf filnumzclosf outzclosf pclosezclosf pexitstatzclosf fp[filnum]zclosf fp[ZSYSFN]zclosf killing pidzclosf wait statuspzclosf wait pexitstatzxpand entryzxpand isdir 1zxpand isdir 2zxpand okzxpand fcountznextznewn: about to expandznewn matchesznewn number ok.~%d~znewn: too many names.~xxxx~zrename oldzrename new/zrename dirzrename no dirfile[] %s: rename to %s failed (%m)file[] %s: renamed to %s okzcopy src argzcopy dst argzcopy files identical: stat()source file not foundzcopy srczcopy dst 1zcopy files identical: strcmp()zcopy source is directoryzcopy dst 2zcopy open sourcezcopy open destzcopy final readzcopy errnofile[] %s: copy to %s failed (%m)file[] %s: copy to %s okzgperm----------%ozipermzsattr buf.st_mode & 0777zsattr lpermszsattr gpermsU1zdtstr timelocaltime returns nullzdtstr tm_yearzstrdt YEAR-2000 ALERT 1: localtime yearzdatstr year%04d%02d%02d %02d:%02d:%02dzdatstrzfcdatzfcdat xzfcdat stat failedzstrdtBad creation date zstrdt date check 1zstrdt date check 2zstrdt date check 3zstrdt so far so goodzstrdt yearzstrdt fails - yearzstrdt 4 bad date zstrdt 6 bad date zstrdt 9 bad date zstrdt 12 bad date zstrdt 15 bad date zstrdt tmx 1zstrdt tmx 3zstimezstime datezstime: nothing to dozstime: zstrdt failszstime: tmzstime: A-pkt date ok zstime: Can't stat file:zstime lpermszstime gpermszstime system idzstime file perms beforezstime isguestzstime ckxpermszstime isguest sb.st_modezstime octal lpermzstime mask 1zstime mask 2zstime gprotectzstime S_IRUSRzstime S_IWUSRzstime S_IXUSRzstime mask xzstime mask x|maskzstime flagzstime S_IFMT x%04ozstime file perms afterzstime: sb.st_atimezstime setpermszstime DIRECTORY bit onzstime DIRECTORY bit offzstime chmodzstime 0: can't set modtime for filezstime 0: modtime set for filezstime 1: comparepacketmail %s < %szprint filezprint flagszprint printernamezprint printpipecat %s | %scat %s >> %s%s %s < %szprint commandecho%s %ssplitpath**splitpath mallocsplitpath malloc failurefgen patfgen xpatfgen current directoryfgen xpatslashfgen string spacefgen can't malloc string space fgentraverse adding because end of path segmenttraverse XXX sofartraverse XXX xpattraverse XXX pl -> nparttraverse XXX ckmatchtraverse adding because recursive && !isdirtraverse sofartraverse forwardtraverse itswildtraverse existstraverse not foundtraverse sofar 2traverse opening..traverse itsadirtraverse segisdirtraverse adding because recursive && isdirtraverse isdir 2traverse ckmatch 2traverse adding because match && !itsadiraddresultLOGNAMEtilde_expand?Privilege cancellation failure sh-iisdir statisdir errnoisdir statbuf.st_modezmkdirzmkdir tilde_expandzmkdir tp after tilde_expansionzmkdir makingzmkdir failed, errnozfseekzfnqfp fnamezfnqfp zgtdirzfnqfp buf 1zfnqfp buf 2/.////../zfnqfp name?Local resource failure: malloc userzvuser ckxsyslogzvuser CKSYSLOG definedftpanonymouszvuser anonymous ckxanonzvuser anon forbidden by ftpusers filezvuser anon sgetpwnam(ftp) OKzvuser anon sgetpwnam(ftp) FAILEDzvuser sgetpwnam okzvuser shellzvuser getusershellzvuser endusershell 1zvuser endusershell 2zvuser checkuserzvuser refused 1zvuser not refusedzvuser sgetpwnam NULLcheckuser name/etc/ftpuserscheckuser userfilecheckuser linecheckuser REFUSEDcheckuser OKWTMP logoutiksdckermitzsyslog syslog openedxxxxxx(null)zvpassxxzvpass deniediks_%04xWTMP loginzvpass anon chrootzvpass anon chroot FAILEDzvpass anon chdir FAILEDzvpass anon chroot/chdir OKzvpass non-guest chdir FAILEDzvpass non-guest chdir OKzvpass setuid FAILEDzvpass setuid OK(unknown host)login: anonymous %s %sUser %s logged in. login: %s %sUSER=%sLOGNAME=%sHOME=%sC-Kermit functions, 7.0.163, 13 Jan 1999Error receiving fileupdateaskdiscardappendbackupreplacerenameSERIOUS ERROR: encstr data == NULLencstrencstr memptr 1encstr spsizencstr memptr 2encstr string too bigencstr getpkt rcputfilputfil zchout write error, setting czseenBDECODEbdecode write error - errnoDECODEdecode write error - errnomaxdata spsiz 1maxdata spsiz 2maxdata len 1maxdata len 2SERIOUS ERROR: bgetpkt data == NULLbgetpkt bufmaxbgetpkt timeout sizebgetpkt: input errorbgetpkt empty fileSERIOUS ERROR: getpkt data == NULLgetpkt first rtgetpkt zkanji: input errorgetpkt zkanji: empty string/filegetpkt: empty stringgetpkt: empty input functiongetpkt funcstrgetpkt zminchar 1getpkt timeout sizegetpkt: input errorgetpkt empty filegetpkt 1st chargetpkt fmaskgetpkt new rtgetpkt about to call translate functiontcharsetfcharset translate function returnsgetpkt eof crc16getpkt eof ffcgetpkt nleftgetpkt zminchar 2getpkt xlated rnext togetpkt leftovergetpkt osizegetpkt eof/eottinit tcharsettinit fcharsettinit timinttinit spsiztinit getsbufTransaction beginsbinarytextGlobal file mode:Collision action:resetc fsizefnlist: no memory for cmargbuffnlist nfilsfnlist cmargfnlist cmarg2stdinCalibrationsinit xpsinit gnfilToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundNo filespec given!sinit nfilssinit filnamsinit oksipkt pktnumsipkt ksipkt getsbufxsinit krcvfil rdatapCALIBRATENONAMEAccess deniedrcvfil srvcmd 1Receivingrcvfil rcvexceptrcvfil skippingException listrcvfil discard refused: exception listrcvfil cmarg2rcvfil srvcmd 2!%srcvfil pipesendrcvfil rcvfilter rcvfile pipesend filterrcvfil pipename?Sorry, receive filter + filename too long, %d max. Name too longrcvfil asrcvfil dirflgrcvfil ofn1x/dev/nullrcvfil existsrcvfil permsrcvfil appendCan't append to a directory error - can't append to directory appending toCan't rename existing directory error - can't rename directory backup:rcvfil backup ofn1rcvfil backup ofn2 refused: namercvfil overwriteCan't overwrite existing directory error - can't overwrite directoryoverwritingrcvfil updateFile has same name as existing directory error - directory exists:rcvfil bad collision actionrcvfil ofn1rcvfil ofn2rcvfil ofpermsrcvfil calling zmkdirzmkdir fails error - directory creation failure:Directory creation failure. path created:rcvfilx: nrcvfilx: ofn1rcvfil fpfsecsreof fncactreof discardreof discardingreof successreof cxseenreof czseenreof rdatapreof closfreof returnssfile xsfile send filter sfile cmarg2sfile binary 1sfile binary 2sfile sendmodesfile pktnamsfile fnspathsfile fncnvsfile calibratesfile pipesendsfile sndfiltersfile xpathsfile xfncnvFILE%02ldsfile filnam 1sfile pktnam 1sfile pipesend filtersfile pipename?Sorry, send filter + filename too long, %d max. sfile filnam 2sfile pktnam 2sfile error - Recover vs TextRecovery attempted in TEXT mode: %ssfile X packetsfile binarysfile qSending as mode: binary mode: text file character settransparent xfer character setSending from:SFILE fpfsecsSFILE fsecssdata entry, firstsdata drainsdata draining, winlosdata sbufnumsdata countdownsdata nxtpktsdata packetsdata cx/zseen, drainsdata spsizsdata binarysdata paritysdata eof, drainsdata pktnumsdata lensdata datasdata ttchkseof can't get s-buffersxeof nxtpkt failssxeof packetseot nxtpktrpar max 1rpar sprmlenrpar max 2rpar 8bq sqrpar 8bq ebqrparrpar biggest 1rpar rprmlenrpar biggest 2spar packetspar 8bq rqspar 8bq sqspar 8bq ebqspar 8bq rqfspar setting parity to spacespar capasspar lscapuspar lscaprspar ebqflgspar swcaprspar swcapuspar yspar lpcapuspar lp lenspar slow-start spsizspar lp spmaxspar windowspar window after adjustmentspar no windowsspar sending, redefine spmaxspar biggestspar whatruspar streamokspar clearrqspar urclearRemote system type: proto whoareuD7proto special VMS prefixingfileselectfileselect fdatefileselect sndafterfileselect sndbeforefileselect sndnafterfileselect sndnbeforefileselect filesizefileselect sndsmaller skippingfileselect sndlarger skipping*.~[0-9]*~fileselect skipping backupfileselect sndexcept emptyfileselect sndexceptfileselect skippingfileselect selectinggnfile sndsrcgnfile filcntgnfile whatgnfile binary = gnf_binarygnfile pipesendCALIBRATIONTransaction cancelledgnfile czseengnfile filefile EOFgnfile filefile filnamgnfile nfils?Internal error expanding ADD list gnfile addlist filnamgnfile cmlist filnamgnfile ngetpathgnfile getpathgnfile absolute.gnfile wildgnfile zxpandgnfile znextgnfile donegnfile setting sndsrc backgnfile skipping:not sentSkipped EnabledRemote onlyLocal onlyDisabledClient Command Status Description REMOTE LOGIN required Transfer file(s) from server to client. GET %-14s%s Transfer file(s) from client to server. SEND %-14s%s Send file(s) as e-mail. MAIL %-14s%s Assign value to server variable or macro. REMOTE ASSIGN %-14s%s Change server's directory. REMOTE CD %-14s%s Copy a file on the server. REMOTE COPY %-14s%s Delete a file on the server. REMOTE DELETE %-14s%s List files on the server. REMOTE DIRECTORY %-14s%s Exit from Kermit server program. REMOTE EXIT %-14s%s Execute a shell command on the server. REMOTE HOST %-14s%s Send a file to the server for printing. REMOTE PRINT %-14s%s Get value of server variable or macro. REMOTE QUERY %-14s%s Create a directory on the server. REMOTE MKDIR %-14s%s Remove a directory on the server. REMOTE RMDIR %-14s%s Rename a file on the server. REMOTE RENAME %-14s%s Set a parameter on the server REMOTE SET %-14s%s Inquire about disk space on the server. REMOTE SPACE %-14s%s Display a server file on your screen. REMOTE TYPE %-14s%s List who is logged in to the server. REMOTE WHO %-14s%s Return the server to its command prompt. FINISH %-14s%s Log the server out and disconnect. BYE %-14s%s REMOTE HELPC-Kermit %s,%s Internet Kermit Service (EXPERIMENTAL) typefuncnxtnxtdirfunclennxtdir funcbufcnxpnd???????? ??:??:??%10s%10s %s %s %10s %s %s %10s%10ld %s %s %10ld %s %s syies%sSummary: %ld director%s, %ld file%s, %ld byte%s%snxtdir funclensnddirsnddir zfnqfp./*snddir name 1snddir name 2Listing files: %s%s%s*/*snddir directorysnddir zxpandREMOTE DIRECTORY %sREMOTE DIRECTORYsinit()skipping %10s: %s%sdeleted directory: %s%s%s%ld file%s deleted, %ld byte%s freed%sDeleting "%s"%sREMOTE DELETEDirectory requested: cwdChanged directory tocwd failedFailed to change directory tosyscmdsyscmd zxcmd oksyscmd zxcmd failedremsetremset xfer charset lookupadjpkl lenadjpkl slotsadjpkl bufsizadjpkl new lenwhoarewe xfermodewhoarewe g_xfermodewhoarewe remote sysidL3N3whoarewe flagRTT RECVRTT RECV ERROR spacketsRTT RECV ERROR sequenceRTT SENDRTT SEND ERRORRTT stddev1RTT stddev2RTT delay RTT rcvtimoinput sstateinput nakstateinput sndtypinput xitstainput whatinput CONNECTION BROKENinput winloinput rseqtbl[winlo]input return pre-stashed packetinput echo discardedinput type D=input typeUser cancelled.FAILED - InterruptedFAILED - Connection lostrpack receive window fullReceive window full.Transmission error on reliable link.input got E, nakstateZZZ crunched zZZZ xZZZ x not recd yetZZZ x not NAK'd yetZZZ NAKing winloToo many retries.input receive-state timeout, winloinput sending NAK for winloinput sent too many naksinput rsn=winloinput out of sequence, rsninput rseqtbl[rsn]input recv can't find index for rcvd pktSliding windows protocol error.input recv chkwinSequence error on reliable link.STREAMING input streamingSTREAMING input sndtypinput send returning pre-stashed ACKinput streaming typeinput sendecho discardedInterruptedConnection lostReceive window full wslots winlo pktnuminput send got E, nakstateToo many retriesinput send state timeout, winloinput send resending winloinput send too many resendsinput T cut packet lengthinput send rsninput send winloinput send chkwinbestlen ack xbestlen ack typebestlen Bbestlen retrybestlen lenbestlen spacketsbestlen Abestlen wslotsbestlen maxsendbestlen spsiz Abestlen spsiz Bbestlen spsiz Cbestlen spsiz Dinput send rotated send windowinput send mark pktinput send ACK for previousinput send ACK out of windowNAK received on reliable link.input send NAKinput N cut packet length in windowNAK for next packet, windowingNAK for next packet, no windowing NAK out of windowNAK out of windowinput send unexpected typeinput about to flushinput returning typeparchk nparchk startchktimo streamingchktimo timochktimo flagchktimo spmaxchktimo urpsizchktimo plenchktimo new timospack nspack dataspack dspack lenspack copyspack mydataspack sseqtbl[n]spack sending packet out of windowSTREAMING spack skippingspack ttol returnsFAILED: Connection lostspack ttol msecspack calling screen, mydata=v@@nxtpkt pktnumnxtpkt winlo nxtpkt nnxtpkt chkwinnxtpkt getsbuf failureSTREAMING fastack kSTREAMING fastack can't getsbufSTREAMING fastack xacknsackns kackns can't getsbufackns winloackns nack1nack bad pkt numnacknack can't getsbufresend seqRetransmissionRESEND PKT NOT IN WINDOWRESEND kresend pktinfo index retry(resend)resend ttol msecresend ttol returns@@errpktProtocol Error:errpkt drainingDraining incoming packets, wait...Drain complete.6?GET Packet Internal Error 1sopkt NULL listsopktsopkt encstrsopkt overflowGET Packet Too Long for Serversopkt leftoversopkt fieldGET Packet Internal Error 8@ sopkt o->opktitemsopkt datasopkt opktcntGET Packet Internal Error 9sopkt pktnumsopkt spackSend Packet Failuresopkt rcsrinit recursivesrinit regetsrinit retrievesrinit opktsrinit ooptssrinit omodesrinit cmargGET with no filenamesrinit null cmargGET Packet Internal Error 2srinit malloc fail O1Ox%dGET Packet Internal Error 3srinit malloc fail O2GET Packet Internal Error 4srinit malloc fail M1Mx%dGET Packet Internal Error 5GET Packet Internal Error 6srinit malloc fail F1GET Packet Internal Error 7srinit malloc fail F2kstart SOPkstart EOLkstart EOP chkspktkstart ksbufB00zstart Zmodem SOPZmodem downloadreceive /protocol:zmodemset proto kermit, server, set protocol gset proto kermit,server,set proto xmodemset proto kermit,server,set proto xmodem-crcset proto kermit,server, set protocol yset proto kermit,server,set proto zmodemserverreceive /protocol:kermitrpack pktnumrpack ksbufautodownload parityautodownload parchkrpack timintrpack rcvtimorpack streamingrpack timint 0 but rcvtimorpack ttinl lenrpack ttinl msecrpack: ttinl failsrpack ^C serverrpack ^C en_finBad packet headerrpack packet length less than 3Bad packet lengthrpack bad sequence numberBad sequence numberrpack echorpack bctlrpack chklenpacket too longrpack block check Bchecked charsblock checkshould beChecksum errorCRC errorbad type B block check(crunched)rpack block check OKrpack got dupv@@%c-xx-%02d-%c-%02d-%02d- tstats xfsecststats filcnttstats fpxfsecststats fptsecsTransaction complete files transferred total file characters communication line in communication line out elapsed time (seconds) effective data rate {Gzt?A{Gzt?Afstats tfcfstats whatfstats epktmsg complete, sizeinibufs sinibufs rini_pkts: no memory for s_pktinibufs size 1inibufs size zinibufs overflowinibufs bigbuf malloc failedinibufs size 2inibufs bigsbsizinibufs bigrbsizmakebufmakebuf bufsizmakebuf MAXWSmksbuf makebuf returnmkrbuf makebuf returnwindowgetsbuf bad arggetsbuf packetgetsbuf pgetsbuf data == NULLgetrbuf new rbufnumfreesbuf sseqtbl[n]freerbuf no such slotfreerbuf packetfreerbuf rbufnumfreerpkt seqchkwin packetchkwin winlochkwin slotsSEND BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d ...[%.72s%s] [(empty string)] [(null pointer)] free: %d, winlo: %d RECEIVE BUFFERS:sattr flagsattr zsattrsattr init max%ld%d@sattrsattr numsetsattr leftsattr sendingname>=<;:98765432sys-dependentformatoriginprotectiondispositionencodingaccessblocksizepasswordareaaccountcreatordatetypesizeunknownrsattrrsattr refused refused:rsattr RESEND nrsattr RESEND zrsattr RESEND sendstartgtattr: no memory for dsbufgattr file typegattr binary refused: typegattr attribute A = textgattr attribute B = binary refused: dategattr encodinggattr xfer charset lookupgattr: xfer charset unknown refused: character setgattr switch tcharsetgattr fcharsetgattr switch fcharsetgattr unk encoding attribute refused: encoding refused: bad disposition refused: mail disabled refused: print disabledgattr RESENDgattr: no memory for spbufgattr length refused: length bytes refused: length Kgattr fsizeN+gattr RESEND not binarygattr RESEND OKN?gattr returninitattr ofpermsAttributes for incoming file length in K file type creation date creator account area password blksize access encoding disposition lprotection gprotection systemid recfm sysparam length replyopena fopena discardopena xflgopena remfileopena remappdopena dispopen dispositionopena disposopena rename failsCan't create backup fileopena rename okopena [file]=mode: local name: mode: binary mode: text file character-set: xfer character-set: opena charsetCan't open output fileFailure to openError:opena erroropenc zxcmdcanned: cxseen czseenopeni nameopeni sndsrcopeni file numberaccess deniedopeni CD disabledAccess deniedCommand or pipe failureopeni pipesend zxcmdopeni zopeni 1openi zopeni 2Can't open fileopeni failedopeni messageopeno stdouf zopenoopeno: name open cancelledopeno pipesendopeno zxcmdauthorization failureopeno CD disabledopeno failedopeno ok, nameopent zopenockopenx fsizeclsif i_isopenclsif zcloseclsif successclsif xferstatclsif fsizeclsif ffcclsif cxseenclsif czseenclsif discardInterruptedRefused: %sclsif fstatsIncompleteclsof dispclsof cxseenclsof successclsof o_isopenFailure to closeCan't close fileIncomplete: discarded incomplete: discardedDiscardedclsof fstats 1Incomplete: Kept incomplete: keptclsof fstats 2ckmkdir 1 fcmkdirrmdir%s: no name givenckmkdir 2+UNIXOROSKckmkdir 3ckmkdir 4ckmkdir rccreationremovalDirectory %s not implemented in this version of C-Kermit%s %s: %s%s: removedCharacter Set Translation 7.0.030, 10 Nov 1998latin9-isoI6/203ISO 8859-15 Latin-9greek-isoI6/126ISO 8859-7 Latin/Greekhebrew-isoI6/138ISO 8859-8 Latin/Hebrewjapanese-eucI14/87/13Japanese EUCcyrillic-isoI6/144ISO 8859-5 Latin/Cyrilliclatin2-isoI6/101ISO 8859-2 Latin-2latin1-isoI6/100ISO 8859-1 Latin-1asciiASCIItransparentTRANSPARENTlatinlatilatlalelot928-greekmazovia-pcPolish Mazovia PC Code Pagecp1250Windows Code Page 1250bulgaria-pcBulgarian PC Code Pagecp1251-cyrillicWindows Code Page 1251cp855-cyrillicPC Code Page 855cp858PC Code Page 858cp869-greekCP869 Greekelot927-greekELOT 927 Greekcp862-hebrewCP862 Hebrewhebrew-7Hebrew-7 DECdec-kanjiJapanese DEC Kanjishift-jis-kanjiJapanese Shift JISjis7-kanjiJapanese JIS7koi8-cyrillicOld KOI-8 Cyrillicshort-koiShort KOIcp866CP866 Cyrillichp-roman8Hewlett Packard Roman8dg-internationalData General Internationalmacintosh-latinApple Macintosh Latincp852PC Code Page 852cp850PC Code Page 850cp437PC Code Page 437next-multinationalNeXT Multinationaldec-multinationalDEC MultinationalswissSwiss NRCswedishSwedish ISO-646spanishSpanish ISO-646portuguesePortuguese ISO-646norwegian/danishNorwegian/Danish ISO-646italianItalian ISO-646hungarianHungarian ISO-646germanGerman ISO-646canadian-frenchCanadian-French NRCfrenchFrench ISO-646finnishFinnish ISO-646dutchDutch ISO-646britishBritish/UK ISO-646US ASCIInorwegianhebrewhebrehebrhebhefr-canadiandanishcp866-cyrilliccp1252apple-quickdrawSwissSwedishSpanishRussianPortugueseNorwegianJapaneseItalianIcelandicHungarianHebrewGreekGermanFrenchFinnishDutchDanishASCII (American English)ukrainianrussiannonejapaneseicelandicgreekenglishWart Version 2.13 23 Nov 1998C-Kermit Protocol Module 7.0.118, 5 Jan 1999streamonstreamoffserver=1RESUMEserver=0x justone 1x justone 2User cancelledLogin requiredSEND disabledreceive download dirreceive current dirreceive zchdir okreceive zchdir failedSent G packetREGET sstateCPCPRO YCPCPRO Y xCPCPRO Y not changing stateGETserverDeleting files is disabledGET /DELETEGET /RECURSIVEGET /RECURSIVE /DELETEGET /RECOVERCKCPRO O sgetinit failCKCPRO O sgetinit doneEXTENDED GETCKCPRO O sgetinit TBCCKCPRO O sgetinit failCKCPRO O sgetinit doneCKCPRO O sgetinit TBCBadly formed server commandREMOTE HOST disabledHOST commands not availableREMOTE HOSTCan't do system commandQUIT disabledInterruptedDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE LOGIN x_loginREMOTE LOGIN x_loggedAlready logged in.REMOTE LOGOUTLogged outREMOTE LOGIN lenREMOTE LOGINUsername too longREMOTE LOGIN 1REMOTE LOGIN 2REMOTE LOGIN 3REMOTE LOGIN 4Logged inLogged in as guest - restrictions applyLogin failedAccess denied.Logout ignoredLogin ignored.Logout ignored.REMOTE CDREMOTE CD disabledCan't change directoryREMOTE TYPE disabledREMOTE PWDREMOTE DIRECTORYREMOTE DIRECTORY disabledAccess deniedNo files matchCan't list directoryREMOTE DELETEREMOTE DELETE disabledIt's a directoryFile not foundDELETE failedFINISHFINISH disabledREMOTE EXITEXIT disabledBYEBYE disabledC-Kermit BYE - Loggin out...REMOTE HELPCan't send helpREMOTE RENAMEREMOTE RENAME disabledCan't rename fileREMOTE COPYREMOTE COPY disabledCan't copy fileREMOTE SETREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPECan't type fileREMOTE MKDIRREMOTE MKDIR disabledDirectory access restrictedDirectory creation failureREMOTE RMDIRREMOTE RMDIR disabledDirectory removal failureREMOTE SPACEREMOTE SPACE disabledCan't check spaceREMOTE WHOREMOTE WHO disabledCan't do who commandREMOTE QUERYREMOTE QUERY disabledCan't get valueValue too longCan't send valueREMOTE ASSIGN disabledREMOTE ASSIGN failedUnimplemented REMOTE commandCan't open fileError writing dataCan't open windowX%s -s %c%s%c %s%s %sckcpro.w B tmpdir restoringZCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileRESEND capabilities not negotiatedCan't execute command remote name:Can't send attributesD deleting moving source to renaming source tosseot justoneUnknown errorckcpro.w justone at E pktProtocol errorckcpro.w E tmpdir restoredUnexpected packet typeTelnet Kermit Option negotiation failure IKS client/server failure failed:proto xferstatxxproto entry justone?No connection Sorry, you must 'set speed' firstfailed: proto ttopen localCan't open lineproto ttopen localCan't condition lineproto ttgmdmCarrier required but not detectedsrgcjhk ckcpro ttruncmd?Sorry, no external protocol defined for %s server backgrdserver quietSHOULD NOT SEE THIS IF IN BACKGROUND!KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.KERMIT READY TO SERVE... Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...proto calling wart, justoneC-Kermit server doneGET disabledsgetinit whatrusgetinit binary (1)sgetinit binary (2)sgetinit csgetinit lensgetinit psgetinit O valsgetinit M valsgetinit filenamesgetinit EOPUnknown GET Parametersgetinit unknown parametersgetinit unquoted filenamesgetinitsgetinit pipesendsgetinit O-Packet TBCsgetinit O-Packet done - havefsGET without filenameCommand package 7.0.106, 1 Jan 1999Command? %s %s%s%s ?Memory allocation failure ?Name too long - %s PROMPT sxPROMPT sy %spushcmd: savbuf:fatal error: unable to allocate command buffers&cmpushcmpush: no memory for cmp&cmpopcmnum: illegal radix - %d cmnum: cmfldcmnum 1st chknum okcmnum xxesc okcmnum zpcmnum 2nd chknum okcmnum xxesc 2 okcmnum exp eval okOutput filecmofi cmfld returnscmofi 1.5cmofi 2?Name too long cmofi 3?Wildcards not allowed - %s cmofi 4cmofi 5: is directory/dev/ttycmofi 6: failure?Write permission denied - %s cmofi 7: okcmifi2 path?Default name too long cmifi gtwordcmifi switch xCommand or field too long cmifi atxbufExpanded name too long ?cmifi: malloc error cmifi svcmifi itsadircmifi y itsadircmifi y pre-zxpandcmifi y zxpandcmifi y atmbufcmifi sv wildWildcard matches more than one directory ./cmifip add pathdirectoriesfiles?No %s match - %s ?Too many %s match - %s cmifi sv not wildcmifi nfiles?Not a directory - %s ?Read permission denied - %s ?File not readable - %s ?File not found - %s cmifi esc, xc%s Default name too long %c.. cmifi zxpandcmifi mtchs[0]cmifi filbufcmifi partialcmifi partial k%scmifi partial cmdbuf?Partial name too long cmifi partial atmbufcmifi unique?Directory name too long cmifi directory atmbufcmifi VMS erasing?Completed name too long Directory name Input file specification %s?Expanded name too long cmifi ? *xp, cccmifi ? wild: %s %s%s, one of the following: ?Default too long cmfld: gtwordcmfld xValue too long cmfld returns Please complete this field %s%scmtxt, cmflgscmtxt: fresh startcmtxt:?Timed out cmtxt (*f)cmtxt: gtword xcmtxt calling (*f)cmtxt (*f) returnscmtxt: addbuf Text string?Unexpected return code from gtword() - %d ?Keyword table missing cmkey: pmsgcmkey: cmflgscmkey: cmdbufcmkey table lengthcmkey cmflgscmkey zzcmkey cccmkey gtword xccmkey atxbuf after *fEvaluated keyword too long ?Not a switch - %s ?Ambiguous - %s cmkey token:?No keywords match - %s cmkey Esc cccmkey: defaultcmkey Esc pmsgcmkey lookup ycmkey lookup zcmkey partial zcmkey partial ncmkey partial jcmkey partial kcmkey partial len?No keywords match - "%s" cmkey flgs%s:cmkey: addbuf?Evaluated keyword too long No keywords match One of the following: %s, one of the following: or the name of a macro ("do ?" for a list) or the token %c or one of the tokens: %s %d - Unexpected return code from gtword cmkey gtword zzseptemberoctobernovembermaymarchjunejulyjanuaryfebruarydecemberaugustapril00cmcvtdatecmcvtdate nowcmcvtdate date too long 00:00:00cmcvtdate yyyymmddcmcvtdate yyyymmdd hh:mm:sscmcvtdate yyyymmdd ???cmcvtdate date bad timesepcmcvtdate null ztimecmcvtdate emtpy ztimecmcvtdate fail Acmcvtdate fail Bcmcvtdate fail C%02dcmcvtdate fail Dcmcvtdate fail Ecmcvtdate dotime scmcvtdate dotime pcmcvtdate fail K%s%s%02dcmcvtdate timesep:cmcvtdate fail Fcmcvtdate time icmcvtdate time fld[0]cmcvtdate time fld[1]cmcvtdate time fld[2]cmcvtdate fail Gcmcvtdate fail Hcmcvtdate fail Icmcvtdate fail Jcmcvtdate yearcmcvtdate monthcmcvtdate xcmcvtdate hhcmcvtdate mmcmcvtdate ss%s%s%02d %02d:%02d:%02dcmcvtdate hourcmcvtdate minutecmcvtdate secondcmcvtdate resultDate and/or timecmdate 1cmdate 2?Evaluated date too long Invalid date or time - "%s" commandOops, command recall error cmcfm: cmflgscmcfm: atmbuf?Not confirmed - %s Type a carriage return to confirm the command cmfdb in->fcodecmfdb cmnumcmfdb cmoficmfdb cmifi2cmfdb cmfldcmfdb cmtxtcmfdb cmkeycmfdb cmcfmcmfdb - unexpected function code?cmfdb - unexpected function code: %d cmfdb xcmfdb cmflgscmfdb crflagcmfdb qmflagcmfdb esflagcmfdb out->nresultcmfdb cmdbuf & crflagcmfdb codecmfdb failure x?Not valid in this position: "%s" ungword cmflgsunungw atmbufgtword brkchargtword brkgtword ungetting from pp?Saved word too long gtword returning atmbufgtword cmdbufgtword bpgtword ppgtword timelimitgtword cgtword echofcgtword IACgtword skipping CRgtword CR to LFgtword LFgtword skiping LFgtword NUL to LFgtword NULgtwordexitinggtword c < 0gtword EOFgtword chargtword echof 2?Field too long error 1 gtword too long #1erasinggtword iscontdgtword too long #2?Field too long error 2 gtword too long #3?Too long #3 gtword too long #4?Too long #4 %s %s%sgtword quote 0gtword quote 1gtword quote 3gtword quote?Command too long, maximum length: %d. pushccmdgetc() chknumMore info at the Kermit Project website, http://www.columbia.edu/kermit/.book are the primary source of funding for C-Kermit development and support.It shows you how to use C-Kermit and answers your questions; sales of thisTo order: +1 212 854-3703 or +1 800 366-2665. PLEASE PURCHASE THE MANUAL.2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone, Type HELP OPTIONS for help with command-line options. for a menu (context-sensitive help, menu on demand). Press ? (question mark) at the prompt, or anywhere within a command, Type SUPPORT to learn how to get technical support. Type NEWS for news about new features. Type MANUAL to access the C-Kermit manual page. Type HELP followed by a command name for help about a specific command. Type VERSION for version and copyright information. Type INTRO for a brief introduction to C-Kermit.Trustees of Columbia University in the City of New York. check with the Kermit Project to see if there have been updates.If the release date shown by the VERSION command is long past, be sure toa supplement to the manual, "Using C-Kermit", second edition (1997).These new features are documented in the ckermit2.txt file, to be used as . Bug fixes. . Performance improvements. . New MANUAL command to access online documentation. . New selection of transaction-log formats. . New script programming features, functions, and variables. . Automatic character-set switching. . New Euro-compliant and other character sets. . Greek character sets. . Improvements in CD and other directory-related commands. . File-permission preservation in UNIX and VMS. . More serial speeds, data-bits/parity/stop-bits options. . Numerous modem and dialing improvements. . More-flexible wildcards for filename matching. . New streaming Kermit protocol for reliable connections. . File-transfer pipes and filters. . File-transfer selection and other option switches. . Fast Kermit protocol settings are now the default. . Configurability as an Internet Kermit Service Daemon.Major new features (not necessarily available on all platforms) include:This is a TEST version, not for production use.Welcome to C-Kermit 7.0.195 Beta. USA New York NY 10025-7799 Fax: +1 (212) 663-8202 612 West 115th Street Voice: +1 (212) 854-3703 Columbia University Web: http://www.columbia.edu/kermit/ The Kermit Project E-mail: kermit-orders@columbia.edureleases, and information about other Kermit software, contact: where xxx is the name of the command. For documentation, news of new For further information about a particular command, type HELP xxx, FAST (combination of the three above) SET PREFIXING (reduce prefixing overhead) SET WINDOW (use sliding windows) SET RECEIVE PACKET-LENGTH (use bigger packets) To speed up file transfers: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc. To display other settings: SHOW ESCAPE To display your escape character: Type your escape character followed by the letter C. To return from a terminal connection to the C-Kermit prompt: TELNET select a TCP/IP host and CONNECT to it CONNECT begin terminal connection SET HOST select network host SET NETWORK TYPE select network type LOOKUP lookup entries in your network directory SET NETWORK DIRECTORY specify a network services directory (optional) To make a network connection:(*) (For use with optional dialing directory)Further info: HELP DIAL, HELP SET MODEM, HELP SET LINE, HELP SET DIAL DIAL dial the phone number SET MODEM TYPE select modem type LOOKUP lookup entries in your dialing directory (*) SET DIAL AREA-CODE area-code you are dialing from (*) SET DIAL COUNTRY-CODE country you are dialing from (*) SET DIAL DIRECTORY specify dialing directory file (optional) To dial out with a modem: CONNECT begin terminal connection SET SPEED select communication speed SET LINE select serial communication device To make a direct serial connection: SET FILE file settings, for example TYPE TEXT or TYPE BINARY SET FLOW communications flow control, such as RTS/CTS SET PARITY communications parity Important settings: SERVER be a Kermit server REGET recover an interrupted get from a server RESEND recover an interrupted send GET get files from a Kermit server RECEIVE receive files SEND send files Commands for file transfer: TAKE execute commands from a file HELP command request help about the given command HELP request general help EXIT exit from C-Kermit Basic C-Kermit commands: Command words other than filenames can be abbreviated in most contexts. or introduce a backslash code, variable, or function. . \ (backslash) include the following character literally . ESC (or TAB) Attempt to complete the current field. . ? (question mark) Display a menu for the current command field. . CTRL-N: Command recall - go forward in command recall buffer. . CTRL-B: Command recall - same as Ctrl-P. . CTRL-P: Command recall - go backwards in command recall buffer. . CTRL-R: Redisplay the current line. . CTRL-U: Delete the current line. . CTRL-W: Delete the most recent word typed. . DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. While typing commands, you may use the following special characters: . TCP/IP network connections . Automatic modem dialing . Serial connections, direct or dialed. Supporting: . International character set conversion . Script programming . Terminal connection . Error-free and efficient file transferWelcome to UNIX C-Kermit communications software for: details on time-of-day format. and IF SUCCESS. Also see MINPUT, REINPUT, SET INPUT. See HELP PAUSE for INPUT waits for any character. For use in script programs with IF FAILURE for the given text to arrive on the connection. If no text is given, Waits up to the given number of seconds, or until the given time of dayExample: INPUT 5 Login: or INPUT 23:59:59 RINGSyntax: INPUT { number-of-seconds, time-of-day } [ text ]Also see SET OUTPUT. \L - Send a Long BREAK signal. \B - Send a BREAK signal. \N - Send a NUL (ASCII 0) character (you can't use \0 for this). etc, plus the following special codes: during CONNECT mode. The text may contain backslash codes, variables, Sends the text out the communications connection, as if you had typed itSyntax: OUTPUT text Also see SET TERMINAL BYTESIZE, SET SERIAL, and SET STOP-BITS. Chooses 8 data bits plus the indicated kind of parity.SET PARITY HARDWARE { EVEN, ODD } Forces 8th-bit prefixing during file transfer. Chooses 7 data bits plus the indicated kind of parity.SET PARITY { EVEN, ODD, MARK, SPACE } Chooses 8 data bits and no parity.SET PARITY NONEfor example, SET ESC ^_ sets your escape character to Ctrl-Underscore.letter or one of: @, ^, _, [, \, or ], to indicate a control character;You may also enter the escape character as ^X (circumflex followed by a C-Kermit prompt or followed by ? to see other options. (Control-\). Type the escape character followed by C to get back to the Decimal ASCII value for escape character during CONNECT, normally 28Syntax: SET ESCAPE number Normally ON (they are processed). Whether to process the special OUTPUT-only escapes \B, \L, and \N.SET OUTPUT SPECIAL-ESCAPES { ON, OFF } normally 0. How many milliseconds to pause after sending each OUTPUT character,SET OUTPUT PACING fails. PROCEED (default) allows use of IF SUCCESS / IF FAILURE commands. Tells whether to proceed or quit from a script program if an INPUT commandSET INPUT TIMEOUT-ACTION { PROCEED, QUIT } INPUT command times out, 0 for no maximum. The maximum number to seconds of silence (no input at all) before theSET INPUT SILENCE Tells whether to display arriving characters read by INPUT on the screen.SET INPUT ECHO { ON, OFF } inherited by subordinate macros and take files. This setting is local to the current macro or command file, and is Tells whether alphabetic case is to be significant in string comparisons.SET INPUT CASE { IGNORE, OBSERVE }Whether an INPUT in progress can be can interrupted from the keyboard.SET INPUT CANCELLATION { ON, OFF } Removes the old INPUT buffer and creates a new one with the given length.SET INPUT BUFFER-LENGTH number-of-bytes Controls whether autodownloads are allowed during INPUT command execution.SET INPUT AUTODOWNLOAD { ON, OFF }Syntax: SET INPUT parameter value variable should cause a command to fail. OFF by default. Whether an illegal function call or reference to a nonexistent built-inSET FUNCTION ERROR { ON, OFF } references to nonexistent built-in variables. ON by default. Whether to issue diagnostic messages for illegal function calls andSET FUNCTION DIAGNOSTICS { ON, OFF }use redirectable standard input/output.External protocols require REDIRECT and external file transfer programs that set proto ymodem rb {rb -a} {sb %s} {sb -a %s} rb rb set proto kermit {kermit -YQir} {kermit -YQTr} {kermit -YQx} spaces. Examples: to represent the filename(s). Use { braces } if any command contains receiving files with this protocol. Use "%s" in any of these strings in binary or text mode, respectively; s5 and s6 are the commands for s4 are commands used on this computer for sending files with this protocol the remote computer, and there are no s4-s6 commands. Otherwise, s3 and If the protocol is KERMIT, s3 is the command to start a Kermit server on RECEIVE process on the other end in binary or text mode, respectively. output prior to SENDing with this protocol, to automatically start the Selects protocol to use for transferring files. s1 and s2 are commands toSyntax: SET PROTOCOL { KERMIT, XMODEM, YMODEM, ZMODEM } [ s1 s2 s3 s4 s5 s6 ]Syntax: BYE Shut down and log out a remote Kermit serverdefaults; use SHOW OPTIONS to display customized defaults.COMMAND MORE-PROMPTING. Use SET OPTIONS DIRECTORY [ switches ] to changeFactory defaults are marked with +. Default for paging depends on SET /REVERSE If sorting, sort in reverse order. /ASCENDING + If sorting, sort in ascending order. /NOSORT + Don't sort. /SORT:key Sort by key, NAME, DATE, or SIZE; default key is NAME. /NORECURSIVE + Don't descend through subdirectories. /RECURSIVE Descend through subdirectories. /ENGLISHDATE In verbose listings, show date in "English" format. /ISODATE + In verbose listings, show date in ISO 8061 format. /NOXFERMODE + Don't show pattern-based transfer mode /XFERMODE Show pattern-based transfer mode (T=Text, B=Binary). /NOHEADINGS + Don't include heading or summary. /HEADINGS Include heading and summary. /NOBACKUP Don't include backup files. /BACKUP + Include backup files (names end with .~n~). /NODOTFILES + Don't include files whose names start with dot. /DOTFILES Include files whose names start with dot (period). /NOPAGE Don't pause after each screenful. /PAGE Pause after each screenful. /ALL + Show both files and directories. /DIRECTORIES Show directories but not files. /FILES Show files but not directories. /VERBOSE + Also list permissions, size, and date. /BRIEF List filenames only. files in it are listed. Optional switches: the current directory are listed. If a directory name is given, all the characters, or a directory name. If no filespec is given, all files in Lists files. The filespec may be a filename, possibly containing wildcardSyntax: DIRECTORY [ switches ] [ filespec ] deletion proceeds silently. RM is a synonym for DELETE. listed as it is processed, with a status indication. If /QUIET is given to match multiple files. If /VERBOSE is included, each filename is The filespec may denote a single file or can include wildcard characters Deletes a file or files on the computer where C-Kermit is running.Syntax: DELETE [ { /QUIET, /VERBOSE } ] filespecSHOW CHARACTER-SETS to list the current settings.Use SHOW ASSOCIATIONS to list the current character-set associations, and to be selected automatically. Synonym: ASSOCIATE TRANSFER-CHARACTER-SET. and SEND CHARACTER-SET is AUTOMATIC, the specified file character-set is either by command or by an announcer attached to an incoming text file, Tells C-Kermit that whenever the given transfer-character set is selected,ASSOCIATE XFER-CHARACTER-SET is selected automatically. SEND CHARACTER-SET (q.v.) is AUTOMATIC, the given transfer character-set Tells C-Kermit that whenever the given file-character set is selected, andASSOCIATE FILE-CHARACTER-SET in ascending order. Sort in reverse order. If this switch is not given, the array is sorted /REVERSE elements 0 through n). a sort, use /RANGE:0 (to sort the whole array) or /RANGE:0:n (to sort :high is omitted, the dimensioned size is used. To include element 0 in is not given, elements 1 through the dimensioned size are sorted. If The range of elements, low through high, to be sorted. If this switch /RANGE:low[:high] Position (1-based column number) at which comparisons begin, 1 by default. /KEY:number omitted, the current SET CASE setting applies. If ON, alphabetic case matters; if OFF it is ignored. If this switch is /CASE:{ON,OFF} the array is excluded from sorting. Switches: Sorts the given array in place according to the switches. Element 0 ofSyntax: SORT [ switches ] array-nameSET FILE).in SWITCH case labels, and in file patterns (see HELP IF, HELP SWITCH, HELPThe same wildcard syntax can be used for patterns in the IF MATCH command,a backslash, e.g. [a\-z] matches a, hyphen, and z rather than a through z.To force a special pattern character to be taken literally, precede it with may themselves contain *, ?, [abc], [a-z], or other lists of strings. ck{ufio,vcon,cmai}.c matches ckufio.c, ckvcon.c, or ckcmai.c. The strings Braces enclose a list of strings to be matched. For example:{string1,string2,...} letter from m through z. Lists and ranges may be combined. This example matches a, c, d, or any[acdm-z] For example, [a-z] matches any character from a to z. the range; a hyphen (-) separates the low and high elements of the range. Square brackets enclosing a range of characters matches any character in[a-z] the list. Example: ckuusr.[ch] matches ckuusr.c and ckuusr.h. Square brackets enclosing a list of characters matches any character in[abc] normal function of question mark, which is providing menus and file lists. question mark to be used for matching by a backslash (\) to override the with ".c". When typing commands at the prompt, you must precede any whose names are exactly 5 characters long and start with "ck" and end? Matches any single character. For example, "ck?.c" matches all files including "ck.c". matches all files whose names start with "ck" and end with ".c"* Matches any sequence of zero or more characters. For example, "ck*.c"This version of Kermit accepts the following wildcards:allowed to operate on only one file, such as TRANSMIT or COPY.that accept filenames also accepts wildcards, except commands that areFor example, in "send *.txt" the asterisk is a wildcard. Kermit commandsA "wildcard" is notation used in a filename to match multiple files.Type HELP LOG and HELP OPEN for further info. WRITE-FILE (opened with OPEN WRITE or OPEN APPEND) READ-FILE (opened with OPEN READ) DEBUG-LOG (opened with LOG DEBUG) PACKET-LOG (opened with LOG PACKETS) TRANSACTION-LOG (opened with LOG TRANSACTIONS) SESSION-LOG (opened with LOG SESSION) CONNECTION-LOG (opened with LOG CONNECTIONS; must be spelled out) current SET LINE or SET HOST connection. The other items are: Close the indicated item. The default item is CONNECTION, which is theSyntax: CLOSE [ item ]Also see: INPUT, REINPUT, SET INPUT. fails, and \v(minput) is set to 0. 1, 2, 3, etc. If none of the strings arrives, the command times out, \v(minput) variable is set to the number of the string that was matched: is encountered within the timeout interval, the command succeeds and the separated by spaces; use { braces } for grouping. If any of the strings the command waits for any character at all to arrive. Strings are strings to arrive on the communication device. If no strings are given, For use in script programs. Waits up to n seconds for any one of theExample: MINPUT 5 Login: {Username: } {NO CARRIER} BUSY RINGSyntax: MINPUT n [ string1 [ string2 [ ... ] ] ] string that might be in effect. it is given, and overrides (temporarily) any global SET TERMINAL TRIGGER all other CONNECT switches applies only to the CONNECT command with which trigger string, if any, that was actually encountered. This value, like Upon return from CONNECT mode, the variable \v(trigger) is set to the /TRIGGER:{{string1}{string2}...{stringn}} specify more than one trigger, use the following format: must enclose it in braces, e.g. "/TRIGGER:{READY TO SEND...}". To colon, e.g. "/TRIGGER:Goodbye". If the string contains any spaces, you command mode. To specify one string, just put it right after the One or more strings to look for that will cause automatic return to/TRIGGER:stringOther switches include:tells you how to escape back, etc. CQ is a synonym for CONNECT /QUIETLY.Include the /QUIETLY switch to suppress the informational message that escape commands. back to the C-Kermit prompt, or followed by ? for a list of CONNECT-mode recent SET HOST command. Type the escape character followed by C to get the most recent SET LINE command, or to the network host named in the most Connect to a remote computer via the serial communications device given inSyntax: CONNECT (or C, or CQ) [ switches ]and does not allow as-names.Just like GET (q.v.) except allows a list of remote file specifications,Syntax: MGET [ switches... ] remote-filespec [ remote-filespec ... ]Also see HELP MGET, HELP SEND, HELP RECIEVE, HELP SERVER, HELP REMOTE. Performs this transfer in text mode without affecting the global/TEXT the files to be sent. Tells the server to descend through the directory tree when locating/RECURSIVE is equivalent REGET. Works only in binary mode. Used to recover from a previously interrupted transfer; GET /RECOVER/RECOVER When sending in local mode, this suppresses the file-transfer display./QUIET after it has been transferred successfully. Asks the other Kermit to delete the file (or each file in the group)/DELETE input/output filter) before being written to disk. Causes the incoming file to passed through the given command (standard/FILTER:command line is interpreted as the name of a command. it on disk. The /AS-NAME or the second "filename" on the GET command Receives the file into the standard input of a command, rather than saving/COMMAND transfer mode. Performs this transfer in binary mode without affecting the global/BINARY /EXCEPT:{{pattern1}{pattern2}...} braces around the group, and inner braces around each pattern: are to be refused. To specify multiple patterns (up to 8), use outer regular filename, or may contain "*" and/or "?" metacharacters, Specifies that any files whose names match the pattern, which can be a/EXCEPT:pattern Overrides the global SET RECEIVE PATHNAMES setting for this transfer./PATHNAMES:{OFF,ABSOLUTE,RELATIVE} Overrides the global SET FILE NAMES setting for this transfer only./FILENAMES:{CONVERTED,LITERAL} GET command line. You can also specify the as-name as the second filename on the Specifies "text" as the name to store the incoming file under./AS-NAME:text switches include: the as-name contain spaces, they must be enclosed in braces. Optional server mode, to send the named file or files. If the remote-filespec or Tells the other Kermit, which must be in (or support autoswitching into)Syntax: GET [ switches... ] remote-filespec [ as-name ]Braces are required if the pipeline or filename contains spaces. log debug {| grep "^TELNET" > debug.log} log transactions |lprNote: The filename can also be a pipe, e.g.:the default for the connection log). Use CLOSE to stop logging.if any, is appended to; otherwise a new file is created (except APPEND isIf you include the APPEND keyword after the filename, the existing log file, options.) current directory; see HELP SET TRANSACTION-LOG for transaction-log format Names and statistics about files transferred (default: transact.log inTRANSACTIONS Records your CONNECT session (default: session.log in current directory).SESSION packet.log in current directory. Kermit packets, to help with protocol problems. The default filename isPACKETS The default log name is debug.log in current directory. Debugging information, to help track down bugs in the C-Kermit program.DEBUG The default filename is CX.LOG in your home directory. Connections made with SET LINE, SET PORT, DIAL, etc.CONNECTIONSRecord information in a log file:Syntax: LOG (or L) filename [ { NEW, APPEND } ] where dashed sequences are followed as long as previous expects fail. -send-expect[-send-expect[...]] may be expressed in the form: that a sequence might not arrive, as with uucp, conditional sequences e.g. ~0 or two adjacent dashes, causes a short delay. If you expect Only the last 7 characters in each expect are matched. A null expect, UUCP systems, sent strings are followed by ~r unless they end with ~c. append a return, and ~o[o[o]] for octal of a character. As with some ~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don't Letters in send may be prefixed by ~ to send special characters: keyword EOT to send Control-D, or BREAK (or \\b) to send a break signal. 'send' is the names, numbers, etc, to return. The send may also be the where 'expect' is a prompt or message to be issued by the remote site, and expect send [expect send] . . . A login script is a sequence of the form: is intended to operate similarly to UNIX uucp "L.sys" entries. Login to a remote system using the text provided. The login script "Using C-Kermit". use the full script programming language described in chapters 17-19 of releases for comptability, but not recommended for use. Instead, please A limited and cryptic "login assistant", carried over from old C-KermitSyntax: SCRIPT text TEXT-PATTERNS Clears the file text-patterns list. SEND-LIST Clears the current SEND list (see ADD). INPUT Clears the INPUT command buffer and the \v(input) variable. DIAL-STATUS Clears the \v(dialstatus) variable. DEVICE-AND-INPUT Clears both the device and the INPUT buffer. DEVICE Clears the current port or network input buffer. BINARY-PATTERNS Clears the file binary-patterns list. APC-STATUS Clears Application Program Command status. ALARM Clears any pending alarm (see SET ALARM).Clears the named item. If no item is named, DEVICE-AND-INPUT is assumed.Syntax: CLEAR [ item-name ]Also see HELP RECEIVE, HELP GET, HELP SERVER, HELP REMOTE. in this file (but a name can contain wildcards). that are to be sent. The filenames should be listed one name per line Specifies the name of a file that contains the list of names of files/LIST:filename are not to be sent. To specify multiple patterns (up to 8), use outer Specifies that only those files smaller than the given number of bytes are/SMALLER-THAN:number Specifies that only those files longer than the given number of bytes are/LARGER-THAN:number Specifies that only those files modified at or after the given date-time/NOT-BEFORE:date-time Specifies that only those files modified at or before the given date-time/NOT-AFTER:date-time are to be sent. Specifies that only those files modified before the given date-time/BEFORE:date-time to be sent. Specifies that only those files modified after the given date-time are/AFTER:date-time transfer without changing global protocol. Uses the given protocol to send the file (Kermit, Zmodem, etc) for this/PROTOCOL:name Sends the file to be printed, with optional options for the printer./PRINT:options Sends the file as e-mail to the given address; use with /SUBJECT:./MAIL:address text contains spaces, it must be enclosed in braces. Specifies the subject of an email message, to be used with /MAIL. If the/SUBJECT:text SEND /STARTING:n filename is equivalent to PSEND filename n. Starts sending the file from the given byte position./STARTING:number the given directory. Tells C-Kermit to move each source file that is sent successfully to/MOVE-TO:directory which is replaced by the original filename. the given name (usually you should include \v(filename) in the new name, Tells C-Kermit to rename each source file that is sent successfully to/RENAME-TO:name all their subdirectories, etc. files that match the filespec, but also in all its subdirectories, and Tells C-Kermit to look not only in the given or current directory for is equivalent RESEND (use in binary mode only). Used to recover from a previously interrupted transfer; SEND /RECOVER successfully (applies only to real files). Deletes the file (or each file in the group) after it has been sent before sending it. Specifies a command (standard input/output filter) to pass the file through Overrides the global SET SEND PATHNAMES setting for this transfer. of a command; the second (if any) is the as-name. The first "filename" on the SEND command line is interpreted as the name Sends the output from a command, rather than the contents of a file. end with .~n~, where n is a number). Skip (don't send) Kermit or EMACS backup files (files with names that/NOBACKUP name. This is equivalent to giving an as-name after the filespec. Specifies as the name to send the file under instead of its real/AS-NAME: Optional switches include: sent under its own name. Also see HELP MSEND, HELP WILDCARD. the files(s) are sent under; if the as-name is omitted, each file is wildcard characters. An 'as-name' may be given to specify the name(s) the SEND-LIST is used (HELP ADD for more info). The filespec may contain Sends the file or files specified by filespec. If the filespec is omittedSyntax: SEND (or S) [ switches...] [ filespec [ as-name ] ]Also see HELP SEND, HELP GET, HELP SERVER, HELP REMOTE. Forces text-mode conversions unless the incoming file has the binary is interpreted as the name of a command. it on disk. The /AS-NAME or the "filename" on the RECEIVE command line attribute Skips text-mode conversions unless the incoming file arrives with binary You can also specify the as-name as a filename on the command line.Optional switches include: incoming file or files will be placed in that directory. the name it arrives with. If the filespec denotes a directory, the files are stored under that name, otherwise it will be stored under SEND command. If the optional as-name is given, the incoming file or Wait for a file to arrive from the other Kermit, which must be given aSyntax: RECEIVE (or R) [ switches... ] [ as-name ]Syntax: RESEND filespec [name] Resend the file or files, whose previous transfer was interrupted. Picks up from where previous transfer left off, IF the receiver was told to SET FILE INCOMPLETE KEEP. Only works for binary-mode transfers. Requires the other Kermit to have RESEND capability.Syntax: REGET filespec Ask a server to RESEND a file to C-Kermit.Syntax: PSEND filespec position [name] Just like SEND, except sends the file starting at the given byte position. /TEXT; see HELP SEND for descriptions. given. Switches include /BINARY /DELETE /MAIL /PROTOCOL /QUIET /RECOVER and they may be in different directories. Alternative names cannot be listed, separated by spaces. Any or all filespecs may contain wildcards Sends the files specified by the filespecs. One or more filespecs may beSyntax: MSEND [ switches... ] filespec [ filespec [ ... ] ] Adds the pattern(s), if any, to the SET FILE TEXT-PATTERNS list.ADD TEXT-PATTERNS [ [ ... ] ] Use SHOW PATTERNS to see the list. See HELP SET FILE for further info. Adds the pattern(s), if any, to the SET FILE BINARY-PATTERNS list.ADD BINARY-PATTERNS [ [ ... ] ] by itself to send the files from it. SEND-LIST and CLEAR SEND-LIST to display and clear the list; use SEND Adds the specified file or files to the current SEND list. Use SHOWADD SEND-LIST filespec [ [ ] ] Removes the given patterns from the SET FILE BINARY-PATTERNS list. Removes the pattern(s), if any, from the SET FILE BINARY-PATTERNS listREMOVE BINARY-PATTERNS [ [ ... ] ]Syntax: SERVER Enter server mode on the current connection. All further commands are taken in packet form from the other Kermit program. Use FINISH, BYE, or REMOTE EXIT to get C-Kermit out of server mode. type HELP SET ? to see what's available. SET parameters. Help is available for each individual parameter; parameters. The SHOW command can be used to display the values of The SET command establishes communication, file, scripting, or other SHOW KEY command. To find out the scan code and mapping for a particular key, use the translation. for the key k. SET KEY mappings take place before terminal character-set key mappings. If there is no text, the default key binding is restored pressed during CONNECT mode. SET KEY CLEAR restores all the default Configure the key whose "scan code" is k to send the given text whenOr: SET KEY CLEARSyntax: SET KEY k text blanks. BLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain no specify more rigorous checking at the cost of higher overhead. The BLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3 Type of packet block check to be used for error detection, 1, 2, 3, orSyntax: SET BLOCK-CHECK type Enables/Disables timestamps on debug log entries.SET DEBUG TIMESTAMP { ON, OFF } Equivalent to SET TERMINAL DEBUG ON. Displays control and 8-bit characters symbolically during CONNECT mode.SET DEBUG SESSION Stops debug logging and session debugging.SET DEBUG OFF Use LOG DEBUG if you want specify a different log file name or path. Opens a debug log file named debug.log in the current directory.SET DEBUG ONSyntax: SET DEBUG { SESSION, ON, OFF, TIMESTAMP } command, separated by spaces. recommended for safety. You can include multiple values in one SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL is character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! UNPREFIXED means you think it is safe to send the given control printable character and prefixed, the default for all control characters. PREFIXED means the given control character must be converted to a The word "ALL" means all characters in this range. is the numeric ASCII code for a control character 1-31,127-159,255.Syntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } Modem command to set the modem's speaker volume.SET MODEM COMMAND VOLUME { LOW, MEDIUM, HIGH } [ text ] Modem command to select tone dialing.SET MODEM COMMAND TONE [ text ] Modem command to select pulse dialing.SET MODEM COMMAND PULSE [ text ] Modem command to disable local flow control in the modem.SET MODEM COMMAND NO-FLOW-CONTROL [ text ] Modem command to turn the modem's speaker on or off.SET MODEM COMMAND SPEAKER { ON, OFF } [ text ] Modem command to enable local software flow control (Xon/Xoff) in modem.SET MODEM COMMAND SOFTWARE-FLOW [ text ] Modem command to enable hardware flow control (RTS/CTS) in the modem.SET MODEM COMMAND HARDWARE-FLOW [ text ] A second INIT-STRING that is to be sent to the modem just prior to dialing.SET MODEM COMMAND PREDIAL-INIT [ text ] for the modem. The 'text' is a replacement for C-Kermit's built-in initialization commandSET MODEM COMMAND INIT-STRING [ text ] Command that tells the modem not to wait for dialtone before dialing.SET MODEM COMMAND IGNORE-DIALTONE [ text ] Command that tells the modem to hang up the connection.SET MODEM COMMAND HANGUP [ text ] Modem commands to turn error correction on and off.SET MODEM COMMAND ERROR-CORRECTION {ON, OFF} [ text ] Modem commands to turn data compression on and off.SET MODEM COMMAND COMPRESSION {ON, OFF} [ text ] Modem commands to turn autoanswer on and off.SET MODEM COMMAND AUTOANSWER {ON, OFF} [ text ]if any:Omitting the optional [ text ] restores the built-in modem-specific command,each modem type, or to fill in commands for the USER-DEFINED modem type.SET MODEM COMMAND commands are used to override built-in modem commands for Selects the desired modem speaker volume for when the speaker is ON.SET MODEM VOLUME {LOW, MEDIUM, HIGH} Kermit should not change its interface speed. the speed reported by the modem's CONNECT message, if any. OFF means ON means that C-Kermit changes its serial interface speed to agree withSET MODEM SPEED-MATCHING {ON, OFF} Turns the modem's speaker on or off during dialing.SET MODEM SPEAKER {ON, OFF} Descriptive name for a USER-DEFINED modem.SET MODEM NAME Specify the maximum interface speed for the modem.SET MODEM MAXIMUM-SPEED use this command to turn its Kermit protocol function on or off. If the selected modem type supports the Kermit protocol directly,SET MODEM KERMIT-SPOOF {ON, OFF} hangup command. RS232-SIGNAL means turn off the DTR signal. escape back to the modem's command processor and give a modem-specific How hangup operations should be done. MODEM-COMMAND means try toSET MODEM HANGUP-METHOD { MODEM-COMMAND, RS232-SIGNAL } Selects the type of local flow control to be used by the modem.SET MODEM FLOW-CONTROL {AUTO, NONE, RTS/CTS, XON/XOFF} For Hayes-compatible modems, Kermit uses three copies, e.g. "+++". Numeric ASCII value of modem's escape character, e.g. 43 for '+'.SET MODEM ESCAPE-CHARACTER number Enables/disables the modem's error-correction feature, if any.SET MODEM ERROR-CORRECTION { ON, OFF } given in your DIAL commands. include '%s' (percent s) as a place-holder for the telephone numbers The text replaces Kermit's built-in modem dialing command. It mustSET MODEM DIAL-COMMAND Enables/disables the modem's data compression feature, if any.SET MODEM COMPRESSION { ON, OFF } Synonym for SET CARRIER-WATCH (q.v.)SET MODEM CARRIER-WATCH { AUTO, ON, OFF } TB Telebit SB speed-buffering KS kermit-spoof SWFC software-flow ITU v25bis-commands HWFC hardware-flow EC error-correction DC data-compression AT AT-commands of a USER-DEFINED modem. Capabilities are: but in fact does not. Also use this command to define the capabilities for example, if your modem is supposed to have built-in error correction Use this command for changing Kermit's idea of your modem's capabilities,SET MODEM CAPABILITIES open the communications device in the correct mode for dialing. Give the SET MODEM TYPE command BEFORE the SET LINE command so Kermit can and SET MODEM COMMAND to tell Kermit how to configure and control it. to Kermit, and then user SET MODEM CAPABILITIES, SET MODEM DIAL-COMMAND, SET MODEM TYPE USER-DEFINED to use a type of modem that is not built in Use SET MODEM TYPE NONE (the default) for direct serial connections. Use list of the modem types known to Kermit, type "set modem type ?". modem-specific commands for configuration, dialing, and hanging up. For a Tells Kermit which kind of modem you have, so it can issue the appropriateSET MODEM TYPE see them. Also see HELP DIAL and HELP SET DIAL.you SET MODEM TYPE, according to the modem's capabilities. SHOW MODEM toNote: Many of the SET MODEM parameters are configured automatically whenSyntax: SET MODEM ... dialing. Use this if internal calls require a special prefix. internal, then this prefix, if any, is added to the number prior to If PBX-EXCHANGE is set, and Kermit determines from it that a call isSET DIAL PBX-INTERNAL-PREFIX the phone number. your PBX, so it can make an internal call by deleting those digits from the leading digits of a local phone number that identify it as being on If PBX-OUTSIDE-PREFIX is set, then you can use this command to tell KermitSET DIAL PBX-EXCHANGE Private Branch Exchange (PBX). Use this to tell Kermit how to get an outside line when dialing from aSET DIAL PBX-OUTSIDE-PREFIX International dialing suffix, if any, to be used with portable dialingSET DIAL INTL-SUFFIX directory entries that result in international calls. Your international dialing prefix, to be used with portable dialingSET DIAL INTL-PREFIX distance dialing prefix. You toll-free dialing prefix, in case it is different from your long-SET DIAL TOLL-FREE-PREFIX [ ] Tells Kermit the toll-free area code(s) in your country.SET DIAL TOLL-FREE-AREA-CODE [ [ [ ... ] ] ] local. For use (e.g.) in France. Whether to force long-distance dialing for calls that normally would beSET DIAL FORCE-LONG-DISTANCE { ON, OFF } be used for appending a calling-card number to the phone number. directory entries that result in long-distance calls. This would normally Long-distance dialing suffix, if any, to be used with portable dialingSET DIAL LD-SUFFIX [ ] directory entries that result in long-distance calls. Your long-distance dialing prefix, to be used with portable dialingSET DIAL LD-PREFIX [ ] directory entries. Normally no suffix is used for local calls. Specifies a suffix to be applied to local calls made from portable dialingSET DIAL LC-SUFFIX [ ] directory entries. Normally no prefix is used for local calls. Specifies a prefix to be applied to local calls made from portable dialingSET DIAL LC-PREFIX [ ] string so do not include your own area code if it should not be dialed. spaces. Any area codes in this list will be included in the final dial require the LD-PREFIX. Up to 32 area codes may be listed, separated by Species a list of area codes to which dialing is local, i.e. does notSET DIAL LC-AREA-CODES [ ]number.country code, followed by area code in parentheses, followed by the phonethe dialing directory; i.e. numbers that start with a "+" sign andThe following commands apply only to portable-format numbers obtained from Establish a suffix to be added after all phone numbers that are dialed.SET DIAL SUFFIX [ text ] for example to disable call waiting. Establish a prefix to be applied to all phone numbers that are dialed,SET DIAL PREFIX [ text ]or found in the dialing directory:The following commands apply to all phone numbers, whether given literally How many seconds to pause between automatic redial attempts; default 10.SET DIAL INTERVAL because automatic redialing is illegal in some countries. no answer, until the call is succesfully answered. The default is 0 How many times to redial each number if the dialing result is busy or noSET DIAL RETRIES calls. If this command is not given, there are no restrictions. SET DIAL RESTRICT LONG prevents placing of long-distance and international Prevents placing calls of the type indicated, or greater. For exampleSET DIAL RESTRICT { INTERNATIONAL, LOCAL, LONG-DISTANCE, NONE } timeout calculation. of 0 turns off this feature and returns to Kermit's automatic dial to override the DIAL command's automatic timeout calculation. A value How many seconds to wait for a dialed call to complete. Use this commandSET DIAL TIMEOUT number modem database. dialer. The default is -1, meaning to use the number from the built-in How many milliseconds to pause between sending each character to the modemSET DIAL PACING number PULSE dialing. Whether to use the modem's DEFAULT dialing method, or to force TONE orSET DIAL METHOD {DEFAULT, TONE, PULSE} Whether to ignore dialtone when dialing; default is OFF.SET DIAL IGNORE-DIALTONE {ON, OFF} Whether to hang up the phone prior to dialing; default is ON.SET DIAL HANGUP {ON, OFF} Whether to display dialing progress on the screen; default is OFF.SET DIAL DISPLAY {ON, OFF} dialed in the order in which they were found. effect, SET DIAL SORT OFF to disable sorting, and the numbers will be sorted in "cheapest-first" order. If this does not produce the desired When multiple entries are obtained from your dialing directory, they areSET DIAL SORT {ON, OFF} one directory, all of them are searched. dialed literally as given in the DIAL command. If you supply more than filenames, the dialing directory feature is disabled and all numbers are The name(s) of your dialing directory file(s). If you do not supply anySET DIAL DIRECTORY [ filename [ filename [ filename [ ... ] ] ] ] conversion, but the parity and speed fields are ignored. it alone (OFF). Old-style directories can still be used without ASK you whether to convert it, or convert it automatically (ON), or leave command tells Kermit what to do when it encounters an old-style directory: The format of Kermit's dialing directory changed in version 5A(192). ThisSET DIAL CONVERT-DIRECTORY {ASK, ON, OFF} displayed if DIAL succeeds and Kermit goes into CONNECT mode. indicate whether the verbose 4-line 'Connecting...' message is to be or AUTO, you may follow this by one of the keywords VERBOSE or QUIET, to DIAL command was issued from a macro or command file. If you specify ON do it if the DIAL command was given interactively, but don't do it if the dialing. ON means to do this; OFF means not to. AUTO (the default) means Whether to CONNECT (enter terminal mode) automatically after successfullySET DIAL CONNECT { AUTO, ON, OFF } in a replacement. Kermit ask you if it is OK to dial the number, and if not, to let you type In case the result might be wrong, you can use SET DIAL CONFIRM ON to have the dialing directory prior to dialing (use LOOKUP to see them). Kermit does various transformations on a telephone number retrieved fromSET DIAL CONFIRMATION {ON, OFF} central London is 171, not 0171. dialing prefix as part of your area code; for example, the area code for local or long distance. Be careful not to include your long-distance tell whether a portable-format phone number from the dialing directory is Tells Kermit the area or city code that you are dialing from, so it canSET DIAL AREA-CODE [ ] know what they really are. should follow this command by DIAL INTL-PREFIX and LD-PREFIX to let Kermit not your true international and long-distance dialing prefixes, then you code 1; 00 and 0, respectively, for all other country codes. If these are command sets default values for them: 011 and 1, respectively, for country If you have not already set your DIAL INTL-PREFIX and LD-PREFIX, then this Japan, ... 351 for Portugal, 47 for Norway, 44 for the UK, 972 for Israel, 81 for Examples: 1 for USA, Canada, Puerto Rico, etc; 7 for Russia, 39 for Italy, dialing directory will result in a national or an international call. from, so it can tell whether a portable-format phone number from your Tells Kermit the telephonic country-code of the country you are dialingSET DIAL COUNTRY-CODE DIAL to display all of the SET DIAL values.dialing the telephone. Also see HELP DIAL and HELP SET MODEM. Use SHOWThe SET DIAL command establishes or changes all parameters related to operating system. Type SET FLOW ? for a list. DTR/CD (hardware) depending on the capabilities of your computer and NONE (no flow control at all), and possibly others including RTS/CTS and change the device's current setting), XON/XOFF (software flow control), Choices: AUTOMATIC (the default, let Kermit choose for you); KEEP (don't Type of flow control to use during file transfer and CONNECT mode.Syntax: SET FLOW value and SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE. COLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAME SET FILE WARNING is superseded by the newer command, SET FILESET FILE WARNING { ON, OFF } performance. change the disk output buffer size; this might make a difference in slower. The optional size parameter after BUFFERED or UNBUFFERED lets you cached disk writes are not lost in a crash, but will probably also be Unbuffered writes might be useful in critical applications to ensure that systems but might also be risky, depending on the underlying file service. blocking writes are normal. Nonblocking writes might be faster on some Lets you control the disk output buffer for incoming files. BufferedSET FILE OUTPUT { { BUFFERED, UNBUFFERED } [ size ], BLOCKING, NONBLOCKING } see SET SEND PATHNAMES and SET RECEIVE PATHNAMES. LITERAL means use filenames literally (useful between like systems). Also (e.g. lowercase to uppercase, extra periods changed to underscore, etc). File names are normally CONVERTED to "common form" during transmissionSET FILE NAMES { CONVERTED, LITERAL } What to do with an incompletely received file: KEEP (default), or DISCARD.SET FILE INCOMPLETE { KEEP, DISCARD } Use this command to specify nonstandard line terminators for text files.SET FILE END-OF-LINE { CR, CRLF, LF } received files go into your current directory. The directory into which all received files should be placed. By default,SET FILE DOWNLOAD-DIRECTORY [ ] NONE No file transfer display at all. This requires a terminal or terminal emulator. FULLSCREEN A fully formatted 24x80 screen showing lots of information. This format can be used on any video display terminal. CRT Numbers are continuously updated on a single screen line. SERIAL One dot is printed for every K bytes transferred. BRIEF A line per file, showing size, mode, status, and throughput. transfer. The choices are: Selects the format of the file transfer display for local-mode fileSET FILE DISPLAY option NOWHERE: Do not put incoming files anywhere (use for calibration). SCREEN: Display incoming files on screen (local mode only). PRINTER: Send incoming files to SET PRINTER device. DISK (default): Store incoming files on disk.SET FILE DESTINATION { DISK, PRINTER, SCREEN, NOWHERE } UPDATE - Accept the incoming file only if newer than the existing file. RENAME - Give the incoming file a unique name. DISCARD - Refuse and/or discard the incoming file. APPEND - Append the incoming file to the end of the existing file. OVERWRITE - Overwrite (replace) the existing file. the incoming file under the name it was sent with. BACKUP (default) - Rename the old file to a new, unique name and store an existing file. The options are: Tells what to do when a file arrives that has the same name asSET FILE COLLISION option Type SET FILE CHAR ? for a complete list of file character sets. Kanji character sets. JAPANESE-EUC, JIS7-KANJI, DEC-KANJI, and SHIFT-JIS-KANJI are Japanese ELOT-927 is like ASCII with the lowercase letters replaced by Greek. GREEK-ISO is ISO 8859-7 Latin/Greek. CP869 is the Greek PC code page. HEBREW-7 is like ASCII with the lowercase letters replaced by Hebrew. HEBREW-ISO is ISO 8859-8 Latin/Hebrew. CP862 is the Hebrew PC code page. page used in Bulgaria SHORT-KOI is a 7-bit ASCII coding for Cyrillic. BULGARIA-PC is a PC code KOI-CYRILLIC, CYRILLIC-ISO, and CP866 are 8-bit Cyrillic character sets. Roman letters. Mazovia is a PC code page used in Poland. LATIN2 is ISO 8859-2 for Eastern European languages that are written with The CPnnn sets are for PCs. MACINTOSH-LATIN is for the Macintosh. NEXT is the 8-bit character set of the NeXT workstation. for Western European languages. national character sets. LATIN1 is the 8-bit ISO 8859-1 Latin Alphabet 1 The names ITALIAN, PORTUGUESE, NORWEGIAN, etc, refer to 7-bit ISO-646 Tells the encoding of the local file, ASCII by default.SET FILE CHARACTER-SET name Normally 8. If 7, truncate the 8th bit of all file bytes.SET FILE BYTESIZE { 7, 8 } in text mode. See HELP WILDCARD for pattern syntax.SET FILE TEXT-PATTERNS [ [ ... ] ] in binary mode. See HELP WILDCARDS for more information about patterns. Zero or more filename patterns which, if matched, cause a file to be sentSET FILE BINARY-PATTERNS [ [ ... ] ] packets and like OFF otherwise. mode. AUTO (the default) is like ON if the other Kermit accepts Attribute in text or binary mode. OFF means to send all files in the prevailing ON means to use filename pattern lists to determine whether to send a fileSET FILE PATTERNS { ON, OFF, AUTO } binary data. Example: SET FILE TYPE BINARY. BINARY means to do no conversion. Use BINARY for executable programs or TYPE is normally TEXT, with conversion of record format and character set. How file contents are to be treated during file transfer.SET FILE TYPE { TEXT, BINARY, ... }Parameters:Sets file-related parameters. Use SHOW FILE to view them.Syntax: SET FILE parameter value complete list of possibilities. numeric code value of the handshake character. Type SET HANDSH ? for a other names like BELL or ESC, or use SET HANDSHAKE CODE to specify the before sending its next packet. Default is NONE; you can give one of the transfer. C-Kermit waits for this character from the other computer Character to use for half duplex line turnaround handshake during fileSyntax: SET HANDSHAKE { NONE, XON, LF, BELL, ESC, CODE number } Default is 0. a NAK while waiting for a command packet. Specify 0 for no NAKs at all. Server command wait timeout interval, how often the C-Kermit server issuesSET SERVER TIMEOUT n is no longer required. account is ignored. If you enter SET SERVER LOGIN by itself, then login the server will respond to any commands other than REMOTE LOGIN. The Sets up a username and optional password which must be supplied beforeSET SERVER LOGIN [ username [ password [ account ] ] ] Default is no GET-PATH, so C-Kermit looks only in its current directory. from client GET commands when the names are not fully specified pathnames. Tells the C-Kermit server where to look for files whose names it receivesSET SERVER GET-PATH [ directory [ directory [ ... ] ] ] file transfer display on the screen. Default is OFF. Tells whether local-mode C-Kermit during server operation should put aSET SERVER DISPLAY {ON,OFF} Synonym: SET CD MESSAGE FILE . To specify more than one filename to look for, use {{name1}{name2}..}. READ.ME (SHOW SERVER tells the current CD-MESSAGE FILE name). Tells the name of the file to be displayed as a CD-MESSAGE, such asSET SERVER CD-MESSAGE FILE name (or similar) file to your screen. command, should send the contents of the new directory's READ.ME Tells whether the server, after successfully executing a REMOTE CDSET SERVER CD-MESSAGE {ON,OFF}for example, RDIR for REMOTE DIR, RCD for REMOTE CD, etc.All REMOTE commands except LOGIN and LOGOUT have R-command shortcuts;further information about a particular remote command 'x'.see a list of available remote commands. Type HELP REMOTE x to getmode on the other end of the currently selected line. Type REMOTE ? toto a Kermit server. There should already be a Kermit running in serverThe REMOTE command sends file management instructions or other commandsAlso see HELP XIF and (for IF MATCH pattern syntax) HELP WILDCARD. ELSE echo It's not less IF < \%x 10 ECHO It's lessThe IF command may be followed on the next line by an ELSE command. Example: FALSE - always fails TRUE - always succeeds (number by itself) - fails if the number is 0, succeeds otherwise >= n1 n2 - n1 is arithmetically greater than or equal to n2 > n1 n2 - n1 is arithmetically greater than n2 <= n1 n2 - n1 is arithmetically less than or equal to n2 < n1 n2 - n1 is arithmetically less than n2 = n1 n2 - n1 and n2 (numbers or variables containing numbers) are equal LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 LLT s1 s2 - s1 is lexically (alphabetically) less than s2 EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal greater than zero (see SET COUNT) COUNT - subtract one from COUNT, execute the command if the result is OPEN { READ-FILE,SESSION-LOG,...} - The given file or log is open NEWER file1 file2 - The 1st file is newer than the 2nd one WRITEABLE filename - Succeeds if the file is writeable READABLE filename - Succeeds if the file is readable DIRECTORY string - The string is the name of a directory ABSOLUTE filename - The filename is absolute, not relative EXIST filename - The named file exists NUMERIC variable or constant - The variable or constant is numeric DEFINED variablename or macroname - The named variable or macro is defined MATCH string pattern - Succeeds if string matches pattern EMULATION - Succeeds if executed while in CONNECT mode ASKTIMEOUT - The most recent ASK, ASKQ, GETC, or GETOK timed out ALARM - SET ALARM time has passed REMOTE-ONLY - C-Kermit was started with the -R command-line option FOREGROUND - C-Kermit is running in the foreground BACKGROUND - C-Kermit is running in the background FLAG - Succeeds if SET FLAG ON, fails if SET FLAG OFF ERROR - Synonym for FAILURE FAILURE - The previous command failed OK - Synonym for SUCCESS SUCCESS - The previous command succeededbe given, and it must appear on the same line as the IF. Conditions are:If the condition is (is not) true, do the command. Only one command maySyntax: IF [NOT] condition command Operators include +-/*(), etc. Example: EVAL (1+1) * (\%a / 3). expression can contain numbers and/or numeric-valued variables or functions. Evaluate an integer arithmetic expression and print its value. TheSyntax: EVALUATE expression both the IF and ELSE parts. The ELSE part is optional. but multiple comma-separated commands may be grouped within braces in Extended IF command. The conditions are the same as for IF (type HELP IF)Syntax: XIF condition { commandlist } [ ELSE { commandlist } ] Example: FOR \%i 10 1 -1 { pause 1, echo \%i } number of times given by the initial value, final value and increment. FOR loop. Execute the comma-separated commands in the commandlist theSyntax: FOR variablename initial-value final-value increment { commandlist } IF commands. commandlist while the condition is true. Conditions are the same as for WHILE loop. Execute the comma-separated commands in the bracketedSyntax: WHILE condition { commandlist }for information about patterns.invocation, a pattern, or any combination of these. See HELP WILDCARDSThe case label "x" can be a character, a string, a variable, a function :default, command, command, ... not match any of the labels: case-list, you can put a "default" label to catch when the variable does where "x" is a possible value for the variable. At the end of the :x, command, command, ..., break The case-list is a series of lines like these: Selects from a group of commands based on the value of a variable.Syntax: SWITCH { case-list } OPEN !READ sort foo.bar OPEN READ oofa.txt from or write to a system command rather than a file. Examples: specified mode: READ, WRITE, or APPEND. !READ and !WRITE mean to read For use with READ and WRITE commands. Open the local file in theSyntax: OPEN mode filenameAlso see SET ASK-TIMER. To include a question mark, precede it by backslash (\). Use braces to preserve leading and/or trailing spaces in the prompt. The characters that you type do not echo on the screen. Issues the prompt and defines the variable to be whatever you type in.Example: ASKQ \%p { Password:}Syntax: ASKQ variablename [ prompt ]Example: ASK \%n { What is your name\? }Syntax: ASK variablename [ prompt ] Issues the prompt and sets the variable to the first character you type.Example: GETC \%c { Type any character to continue...}Syntax: GETC variablename [ prompt ] untimed ASKs after a timed one, use SET ASK-TIMER 0. Also see IF ASKTIMEOUT. seconds with no response. This command is "sticky", so to revert to greater than 0, these commands will time out after the given number of For use with ASK, ASKQ, GETOK, and GETC. If ASK-TIMER is set to a numberSyntax: SET ASK-TIMER number SET BLOCK-CHECK \%b ECHO Today is \%aThese variables can be used almost anywhere, for example: DEFINE \%b 3 DEFINE \%a MondayThe definition of a variable can be anything at all, for example:the macro, or just type its name, followed optionally by arguments.comma-separated list of Kermit commands. Use the DO command to executewhich defines a Kermit command macro called 'vax'. The definition is a DEFINE vax set parity even, set duplex full, set flow xon/xofffor example: DEFINE name command, command, command, ...A typical macro definition looks like this: the definition is omitted, then the named variable or macro is undefined. names are included, rather than their values (compare with ASSIGN). If if the definition includes any variable or function references, their literally. No expansion or evaluation of the definition is done. Thus Defines a macro or variable. Its value is the definition, takenSyntax: DEFINE name [ definition ] This prints 'goodbye hello'. ECHO \%x \%y DEFINE \%a goodbye ASSIGN \%y \%a DEFINE \%x \%a DEFINE \%a hello names. Compare with DEFINE. To illustrate the difference, try this: the values of any variables are contained are used, rather than their The definition string is fully evaluated before it is assigned, so that Assigns the current value of the string to the variable (or macro).Example: ASSIGN \%a My name is \%b.Syntax: ASSIGN variablename string.Examples: DECR \%a, DECR \%a 7, DECR \%a \%n instead. is numeric. If the number argument is given, subtract that number Decrement (subtract one from) the value of a variable if the current valueSyntax: DECREMENT variablename [ number ]Examples: INCR \%a, INCR \%a 7, INCR \%a \%n numeric. If the number argument is given, add that number instead. Increment (add one to) the value of a variable if the current value isSyntax: INCREMENT variablename [ number ] printer. See HELP PRINT for further info. is omitted the default value is restored. SHOW PRINTER lists the current enclosed in braces, e.g. "set printer {| lpr -Plaser}". If the argument given file. If the SET PRINTER argument contains spaces, it must be PRINT command. If a filename is given, each PRINT command appends to the Specifies the command (such as "|lpr") or filename to be used by theSyntax: SET PRINTER [ { |command, filename } ] it is never requested. The default is ON. When EXIT WARNING is ALWAYS, confirmation is always requested. When OFF before EXITing if a connection to another computer might still be open. When EXIT WARNING is ON, issue a warning message and ask for confirmationSyntax: SET EXIT WARNING { ON, OFF, ALWAYS } constant, variable, function result, or arithmetic expression. Set C-Kermit's program return code to the given number, which can be aSyntax: SET EXIT STATUS number is terminated either by the host or by issuing a HANGUP command. When ON, C-Kermit EXITs automatically when a network connectionSyntax: SET EXIT ON-DISCONNECT { ON, OFF } fails, otherwise it succeeds. Synonym: SLEEP. the keyboard unless SLEEP CANCELLATION is OFF. If interrupted, PAUSE second is used. The pause can be interrupted by typing any character on current time, it is assumed to be tomorrow. If no argument given, one day in 24-hour hh:mm:ss notation. If the time of day is earlier than the Do nothing for the specified number of seconds or until the given time ofExample: PAUSE 3 or PAUSE 14:52:30Syntax: PAUSE [ { number-of-seconds, hh:mm:ss } ] 100 milliseconds. Do nothing for the specified number of milliseconds; if no number given,Example: MSLEEP 500Syntax: MSLEEP [ number ] this is usually EXIT or QUIT or LOGOUT) to return to Kermit. system's command line interpreter or shell; exit from it (the command for displays the results on the screen. If the command is omitted, enters the Gives the command to the local operating system's command processor, andSyntax: !, @, RUN, PUSH, or SPAWN, optionally followed by a command. XMIT. See HELP SET TRANSMIT for further information. starting a text editor. TRANSMIT may be interrupted by Ctrl-C. Synonym: must put the other computer in data collection mode, for example by correctly and completely. Before you start the TRANSMIT command, you There can be no guarantee that the other computer will receive the file feedback required. the next line. In binary mode, it is sent a character at a time, with no your keyboard), and C-Kermit waits for a linefeed to echo before sending with carriage return at the end of each line (as if you were typing it at changing the global setting. In text mode, it is sent a line at a time, TEXT), which you can override with a /BINARY or /TEXT switch without The file is sent according to your current FILE TYPE setting (BINARY or the /COMMAND switch is included, the name of a command whose output is filename is the name of a single file (no wildcards) to be sent or, if (or if C-Kermit is in remote mode, displays it on the screen). The to the computer on the other end of your SET LINE or SET HOST connection Sends the contents of a file, without any error checking or correction,Syntax: TRANSMIT { /COMMAND, /TEXT, /BINARY } filename TRANSLATE lasagna.lat latin1 italian lasagna.nrc is chosen automatically, if necessary. Synonym: XLATE. Example: is displayed on the screen. An appropriate intermediate character-set C-Kermit's file character sets. If file2 is omitted, the translation and stores the result in file2. The character sets can be any of Translates file1 from the character set cs1 into the character set cs2Syntax: TRANSLATE file1 cs1 cs2 [ file2 ] ri = Ring Indicate. cts = Clear To Send; dsr = Dataset Ready; cd = Carrier Detect;Signals: from the keyboard during the waiting period. Also see HELP PAUSE. Sets FAILURE if the signals do not appear in the given time or interrupted the specified modem signals to appear on the serial communication device. Waits up to the given number of seconds or the given time of day for all wait 23:59:59 cd wait 5 cd ctsExamples:Syntax: WAIT { number-of-seconds, hh:mm:ss } [modem-signal(s)] TRANSACTION-LOG SESSION-LOG SCREEN (compare with ECHO) PACKET-LOG FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) ERROR (standard error) DEBUG-LOG appropriate code. The name parameter can be any of the following: backslash codes, and is not terminated by a newline unless you include the Writes the given text to the named log or file. The text text may includeSyntax: WRITE name text for further info. portable-format entries based on your locale. HELP DIAL, HELP SET DIAL entry is shown, along with any transformations that would be applied to specified in the most recent SET DIAL DIRECTORY command. Each matching Looks up the given name in the dialing directory or directories, if any,Syntax: LOOKUP name HELP SET MODEM for more info. commands will automatically put it (back) in originate mode. SHOW MODEM, The ANSWER command puts the modem in autoanswer mode. Subsequent DIAL until interrupted, otherwise Kermit waits the given number of seconds. required. If is 0 or not specified, Kermit waits forever or Waits for a modem call to come in. Prior SET MODEM TYPE and SET LINESyntax: ANSWER [ ]Specify your dialing directory file(s) with the SET DIAL DIRECTORY command.country code and area code (see HELP SET DIAL).long-distance, then international, based on its knowledge of your localKermit dials then in cheap-to-expensive order: internal, then local, thenthem until the call is completed; if the entries are in portable format,If more than one entry is found with the same name, Kermit dials all ofPORTABLE entries. If it does not start with +, it is dialed literally.the current locale (HELP SET DIAL for further info); these are calledarea code, and C-Kermit will try to handle these appropriately based onIf a phone number starts with +, then it must include country code and heise +49 (511) 535 2301 ; Verlag Heinz Heise BBS e-mail +1 (212) 555 4321 ; My electronic mailbox work 9876543 ; This is a comment name phonenumber ; commentsA dialing directory is a plain text file, one entry per line:letter, without any directory lookup.after the = to be send literally to the modem, even if it starts with aIf the phonenumber starts with an equals sign ("="), this forces the partname is sent to the modem literally.the number or numbers associated with the name. If it is not found, thelooks it up in the given file(s); if it is found, the name is replaced byDIRECTORY command to specify one or more dialing-directory files, KermitIf the phonenumber starts with a letter, and if you have used the SET DIAL REDIAL, and PDIAL. then DIAL. See also SET DIAL, SET MODEM, SET LINE, SET HOST, SET SPEED, If the modem is on a network modem server, SET HOST first, then SET MODEM, DIAL 7654321 number, for example: SET LINE, then SET SPEED. Then give the DIAL command, including the phone Dials a number using an autodial modem. First you must SET MODEM, thenExample: DIAL 7654321Syntax: DIAL phonenumberService Daemon (IKSD). Type "help iksd" for details.At present, most of the extended options apply only to the Internet Kermitis the option keyword.particular extended option, type "help extended-option xxx", where "xxx"extended options, type "help extended-options". To get help about aextended options, type "help extended-options ?". To get help about allthe built-in banner (greeting) text. To obtain a list of availablewhich designates the file oofa.txt to be printed upon startup, rather than kermit --banner:oofa.txtother extended-option keywords. Example:and they can be abbreviated to any length that still distinguishes them fromUnlike single-letter options, extended option keywords aren't case sensitivehas arguments, a colon (:) or equal sign (=) followed by the argument.These begin with two dashes, followed by a keyword, and then, if the optionC-Kermit also offers a selection of "extended command-line" options.Type "help option x" to see the help message for option x.Type "help options all" to list all the command-line options. name or number. . the -j and -J options allow an optional second argument, the TCP port . The -s option can accept multiple filenames, separated by spaces. items on the command line, and also in the top-level \%1..\%9 variables. data is placed in the argument vector array, \&@[], along with the other treat the rest of the command line as data, rather than commands; this . The special option "=" (equal sign) or "--" (double hyphen) means to from the file. . If the first command-line option is a filename, Kermit executes commandsExceptions to the rules: kermit -Qis oofa.exeAn option that does not require an argument can be bundled with other options: kermit -s "filename with spaces"must be enclosed in doublequotes:require an "argument," others do not. If an argument contains spaces, itCommand-line options are single characters preceded by dash (-). Someissues its prompt.options were given, C-Kermit enters its interactive command parser andafter executing its command-line options. If -S is included, or no actionIf any "action options" are included on the command line, C-Kermit exitsCommand-line options are case-sensitive; "-s" is different from "-S".tells C-Kermit to send (-s) the file oofa.exe in binary (-i) mode. kermit -i -s oofa.execommand that you use to start C-Kermit. Example:Command-line options are given after the program name in the systemExtended argument without the "--" prefix %s %s %s %s A command-line option character, or the word ALL, or carriage return for an overviewallALL?A single character, please, or carriage to list them all. The following command-line options are available: (action option) -%c %s %s Argument: %s -%c %s%s Argument: (none) DOHELP xxSyntax: APC text Echoes the text within a VT220/320/420 Application Program Command.Describes how to get technical support.Syntax: BEEP Sends a BEL character to your terminal.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.DELYour escape character is Ctrl-%c (ASCII %d, %s) Syntax: COPY source destination Copies the file 'source' to 'destination'.Syntax: CD [ directoryname ] Change Directory. If directory name omitted, changes to your home directory. Also see HELP SET CD.Syntax: DECLARE arrayname[size] [ initializers... ] Example: DECLARE \&a[20] Declares an array of the given size. Array elements can be used just like any other variables. Initial values can be given for elements 1, 2, ...Syntax: UNDEFINE variable-name Undefines a macro or variable.Syntax: PDIAL phonenumber Partially dials a phone number. Like DIAL but does not wait for carrier or CONNECT message.Redial the number given in the most recent DIAL commnd.Syntax: LS [ args ] Runs "ls" with the given arguments.Syntax: DISABLE command Security for the C-Kermit server. Prevents the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Executes a macro that was defined with the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1 through \%9.Syntax: ECHO text Displays the text on the screen, followed by a line terminator. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: XECHO text Just like ECHO but does not add a line terminator to the text. See ECHO.Syntax: ENABLE capability For use with server mode. Allows the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exits from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: E-PACKET Sends an Error packet to the other Kermit.Syntax: QUIT (or EXIT) [ number ] Exits from the Kermit program, closing all open files and devices, optionally setting the program's return code to the given number. Also see SET EXIT.Syntax: FINISH Tells the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Prints the prompt, makes user type 'yes', 'no', or 'ok', and sets SUCCESS or FAILURE accordingly. Also see SET ASK-TIMER.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection. %s, Copyright (C) 1985, 1999, Trustees of Columbia University in the City of New York. %s, Copyright (C) 1985, 1999,Give a brief introduction to C-Kermit.Syntax: REINPUT n string Looks for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored.Syntax: RENAME oldname newname Changes the name of file 'oldname' to 'newname'. Introduces a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Equivalent to SEND /MAIL /ADDRESS:xxx filename.MMOVE is exactly like MSEND, except each file that is sent successfully is deleted after it is sent. Prints news of new features since publication of "Using C-Kermit". New features are described in the file DOCS\UPDATES.TXT.Syntax: PING [ IP-hostname-or-number ] Checks if the given IP network host is reachable. Default host is from most recent SET HOST or TELNET command. Runs system PING program, if any.Syntax: FTP [ IP-hostname-or-number ] Makes an FTP connection to the given IP host or, if no host specified, to the current host. Uses the system's FTP program, if any.Syntax: PRINT file [ options ] Prints the local file on a local printer with the given options. Also see HELP SET PRINTER.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Reads a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with \fexecute(macro), which allows macros to be used like functions.MOVE is exactly like SEND, except each file that is sent successfully is deleted after it is sent.Syntax: SUSPEND or Z Suspends Kermit. Continue Kermit with the appropriate system command, such as fg.ParameterHELP SET ySorry, help not available for "%s" Syntax: REDIRECT command Runs the given local command with its standard input and output redirected to the current SET LINE or SET HOST communications path. Synonym: < (Left angle bracket). Display current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS [/BRIEF] Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: TELNET [ host [ service ] ] Equivalent to SET NETWORK TYPE TCP/IP, SET HOST host [ service ] /TELNET, IF SUCCESS CONNECT. If host is omitted, the previous connection (if any) is resumed. HELP SET TELNET for more info.Syntax: RLOGIN [ host [ username ] ] Makes an interactive connection to the host using RLOGIN protocol. If host is omitted, previous connection (if any) is resumed.Syntax: TYPE [ { /PAGE, /NOPAGE } ] file Display a file on the screen. Pauses automatically at end of each screenful if COMMAND MORE-PROMPTING is ON or if /PAGE is included. Can be interrupted with Ctrl-C.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.WRITE-LINE (WRITELN) is just like WRITE, but includes a line terminator at the end of text. See WRITE.Like GOTO, but searches only forward for the label. See GOTO.Declares a variable to be local to the current macro or command file.View the terminal emulation screen even when there is no connection.Synonym for SET FILE TYPE TEXT.Synonym for SET FILE TYPE BINARY.Syntax: DATE [ date-time ] Prints the current date and time in standard format: yyyymmdd_hh:mm:ss. If a date-time is given, converts it to standard format.Just like GET but asks the server to delete each file that has been sent successfully.Equivalent to SET PARITY NONE, SET COMMAND BYTE 8, SET TERMINAL BYTE 8.Syntax: SAVE KEYMAP Saves current keymap definitions to file, "keymap.ini" by default.Syntax: EDIT [ ] Starts your preferred editor on the given file, or if none given, the most recently edited file, if any. Also see SET EDITOR.Syntax: BROWSE [ ] Starts your preferred Web browser on the given URL, or if none given, the most recently visited URL, if any. Also see SET BROWSER.Syntax: CSEND [ switches ] [ ] Sends from the given rather than from a file. Equivalent to SEND /COMMAND; see HELP SEND for details.Syntax: CRECEIVE [ switches ] Receives to the given rather than to a file. Equivalent to RECEIVE /COMMAND; see HELP RECEIVE for details.Syntax: CGET Equivalent to GET /COMMAND; see HELP GET for details.Name of function without \fSyntax: KERMIT [command-line-options] Lets you give command-line options at the prompt or in a script. HELP OPTIONS for more info.Syntax: BACK Returns to your previous directory.Syntax: WHERE Tells you where your file went.Syntax: PIPE [ command ] Makes a connection through the program whose command line is given. Example: pipe rlogin xyzcorp.comSTATUS is the same as SHOW STATUS; prints SUCCESS or FAILURE for the previous command.Syntax: ASSERT Succeeds or fails depending on ; see HELP IF for s.Always fails.Always succeeds.If you haved logged in to C-Kermit as an Internet Kermit server, the LOGOUT command, given at the prompt, logs you out and closes your session.The Internet Kermit Service Daemon can be started only by the system administrator. The IKSD is documented separately.Closes all open files and logs.Syntax: SHIFT [ n ] Shifts \%1..9 variables n places to the left; default n = 1.Syntax: MANUAL [ topic ] Runs the "man" command on the given topic (default "kermit"). %s Synonym: SET XMIT. SHOW TRANSMIT displays current settings. indefinitely for each echo. is ON or TRANSMIT PROMPT is not 0. If 0 is specified, this means wait Number of seconds to wait for each character to echo when TRANSMIT ECHOSET TRANSMIT TIMEOUT number don't wait for a prompt. when TRANSMITting in text mode; normally 10 (Linefeed). 0 means none; ASCII value of character to look for from host before sending next lineSET TRANSMIT PROMPT number or each character (binary mode). How many milliseconds to pause after transmitting each line (text mode),SET TRANSMIT PAUSE number Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE.SET TRANSMIT LOCKING-SHIFT { ON, OFF } Normally, only CR is sent. Transmit Linefeed as well as Carriage Return (CR) at the end of each line.SET TRANSMIT LINEFEED { ON, OFF } Applies only to text mode. 0 by default. ASCII value of a character to insert into blank lines, 0 for none.SET TRANSMIT FILL number Text to send after end of file is reached, e.g. \4 for Ctrl-DSET TRANSMIT EOF text Whether to echo text to your screen as it is being transmitted.SET TRANSMIT ECHO { ON, OFF }Controls the behavior of the TRANSMIT command (see HELP TRANSMIT):Syntax: SET TRANSMIT parameter value even though Kermit thinks it is running in the background. SET BACKGROUND OFF forces prompts and messages to appear on your screenSyntax: SET BACKGROUND { OFF, ON } already configured for maximum-size packet buffers. NOTE: This command is not needed in this version of C-Kermit, which is more window slots. If n2 is omitted, the same value as n1 is used. buffers, respectively. Bigger numbers let you have longer packets and Changes the overall amount of memory allocated for SEND and RECEIVE packetSyntax: SET BUFFERS n1 [ n2 ]Use SHOW COMMAND to display these settings. syntactically incorrect command. ON by default. Whether to reprompt you with the correct but incomplete portion of aSET COMMAND RETRY { ON, OFF } or as ordinary data characters (OFF) in commands. ON by default. Whether to treat backslash and question mark as special characters (ON),SET COMMAND QUOTING { ON, OFF } Whenever you give this command, previous command history is lost. constraints of the computer. A size of 0 disables command recall. holds 10 commands. You can make it any size you like, subject to memory How big you want C-Kermit's command recall buffer to be. By default, itSET COMMAND RECALL-BUFFER-SIZE number you might prefer OFF. scroll by without intervention. If your command window has scroll bars, text that does not fit vertically on your screen. OFF allows the text to ON (the default) enables More?-prompting when C-Kermit needs to displaySET COMMAND MORE-PROMPTING { ON, OFF } purposes of screen formatting. Informs C-Kermit of the number of characters across your screen forSET COMMAND WIDTH purposes of More?-prompting. Informs C-Kermit of the number of rows in your command screen for theSET COMMAND HEIGHT entry and display of 8-bit characters. and your keyboard and screen. 7 is assumed. SET COMMAND BYTE 8 to allow Informs C-Kermit of the bytesize of the communication path between itselfSET COMMAND BYTESIZE { 7, 8 } command mode. ON by default. Enables/Disables automatic recognition of Kermit packets while inSET COMMAND AUTODOWNLOAD { ON, OFF }Syntax: SET COMMAND parameter value to display the CARRIER-WATCH setting. Kermit won't let you, use SET CARRIER-WATCH OFF. Use SHOW COMMUNICATIONS need to CONNECT to a serial device that is not asserting carrier, and capabilities of the underlying OS, drivers, devices, and cables. If you the DIAL command. Correct operation of carrier-watch depends on the AUTO (the default) means carrier is required at all times except during carrier is required at all times. OFF means carrier is never required. on serial communication (SET LINE or SET PORT) devices. ON means that Attempts to control treatment of carrier (the Data Carrier Detect signal)Syntax: SET CARRIER-WATCH { AUTO, OFF, ON } SET ATTR ALL OFF SET ATTR LENGTH ON SET ATTR DATE OFFYou can also specify ALL to select all of them. Examples: TYPE: The file's type (text or binary) SYSTEM-ID: Machine/Operating system of origin LENGTH: The file's length DISPOSITION: Unusual things to do with the file, like MAIL or PRINT DATE: The file's creation date CHARACTER-SET: The transfer character set for text files selected incoming file attributes, including: selected file attributes along with each file, and to handle or ignore Use this command to enable (ON) or disable (OFF) the transmission ofSyntax: SET ATTRIBUTES name ON or OFF inherited by subordinate command files. a command fails. This setting is local to the current command file, and Tells whether a TAKE command file should be automatically terminated whenSET TAKE ERROR { ON, OFF } with a line number). screen (if so, each command is shown at the time it is read, and labeled Tells whether commands read from a TAKE file should be displayed on theSET TAKE ECHO { ON, OFF } Controls behavior of TAKE command:Syntax: SET TAKE parameter valueType SHOW TERMINAL to see current terminal settings. Tells C-Kermit how many columns (characters) are on your CONNECT-mode screen.SET TERMINAL WIDTH additional information. without a string to cancel the current trigger. See HELP CONNECT for session, is to cause automatic return to command mode. Give this command Specifies a string that, when detected during any subsequent CONNECTSET TERMINAL TRIGGER Enables and disables host-initiated transparent printing in CONNECT mode.SET TERMINAL PRINT { ON, OFF } CR (press the Return or Enter key) in CONNECT mode. Tells whether to send CRLF (Carriage Return and Line Feed) when you typeSET TERMINAL NEWLINE-MODE { OFF, ON } switch between 7-bit and 8-bit characters during CONNECT. OFF by default. Tells C-Kermit whether to use Shift-In/Shift-Out (Ctrl-O and Ctrl-N) toSET TERMINAL LOCKING-SHIFT { OFF, ON } Tells C-Kermit how many rows (lines) are on your CONNECT-mode screen.SET TERMINAL HEIGHT Also see HELP SET ESCAPE. when the connection is closed by the other end. USE WITH EXTREME CAUTION. ESCAPE character. If you disable it, Kermit returns to its prompt only Turns on/off the ability to escape back from CONNECT mode using the SETSET TERMINAL ESCAPE-CHARACTER { ENABLED, DISABLED } Specifies which side does the echoing during terminal connection.SET TERMINAL ECHO { LOCAL, REMOTE } commands. characters are displayed symbolically, rather than be taken as formatting Turns terminal session debugging on and off. When ON, incoming controlSET TERMINAL DEBUG { ON, OFF } on your screen. Specifies how incoming carriage return characters are to be displayedSET TERMINAL CR-DISPLAY { CRLF, NORMAL } no translation is done. during CONNECT. By default, both character sets are TRANSPARENT, and you specify two different character sets, C-Kermit translates between them the local character set, the current FILE CHARACTER-SET is used. When character set used by C-Kermit locally, . If you don't specify Specifies the character set used by the remote host, , and theSET TERMINAL CHARACTER-SET [ ] computer or service during CONNECT. Use 7- or 8-bit terminal characters between C-Kermit and the remoteSET TERMINAL BYTESIZE { 7, 8 } mode. Default is OFF. Kermit or ZMODEM packet of the appropriate type is received during CONNECT Enables/disables automatic switching into file-transfer mode when a validSET TERMINAL AUTODOWNLOAD { ON, OFF } all APCs. OFF is the default. and RUN. OFF prevents execution of APCs. UNCHECKED allows execution of disallows potentially dangerous commands such as DELETE, RENAME, OUTPUT, C-Kermit is in CONNECT mode. ON allows execution of "safe" commands and Controls execution of Application Program Commands sent by the host whileSET TERMINAL APC { ON, OFF, UNCHECKED } are running C-Kermit provides the emulation. workstation window, or the terminal emulator or terminal from which you computer or service you have made a connection to. Your console, (or a totally transparent one, if you configure it that way) to the include a terminal emulator. Instead, it is a "semitransparent pipe" This command is not available because this version of C-Kermit does notSET TERMINAL TYPE ...Syntax: SET TERMINAL parameter valueAlso see SET NETWORK, TELNET, SET TELNET.SET HOST name [ port ] /TELNET, IF SUCCESS CONNECTThe TELNET command is equivalent to SET NETWORK TYPE TCP/IP, SET HOST /CONNECT /COMMAND rlogin xyzcorp.com SET HOST xyzcorp.com 2000 /RAW-SOCKET SET HOST madlab.sprl.umich.edu 3000 SET HOST 128.59.39.2 SET HOST /SERVER * 1649 SET HOST * 1649 SET HOST /CONNECT kermit.columbia.edu SET HOST kermit.columbia.edu Send initial Telnet negotiations even if this is not a Telnet port. /TELNET Use Rlogin protocol even if this is not an Rlogin port. /RLOGIN This is a connection to a raw TCP socket. /RAW-SOCKET Do not send initial Telnet negotiations even if this is a Telnet port. /NO-TELNET-INITThe second set of switches can be: Enter server mode automatically if the connection is successful. /SERVER Enter CONNECT (terminal) mode automatically if the connection is successful. /CONNECT given system command, such as "rlogin" or "cu". a list. /NETWORK-TYPE:COMMAND means to make the connection through the type is used only for this connection. Type "set host /net:?" to see NETWORK TYPE name prior to SET HOST, except that the selected network Makes the connection on the given type of network. Equivalent to SET /NETWORK-TYPE:name different service. The first set of switches can be: TELNET; specify a different TCP port number or service name to choose a selected network type. For TCP/IP connections, the default service is Establishes a connection to the specified network host on the currentlySET HOST [ switches ] hostname-or-address [ service [ switches ] ]from the entry, and then try all matching entries until one succeeds.given in the directory and, if found, fill in the additional itemswith the same name. SET HOST and TELNET commands look up theYou can have multiple network directories and you can have multiple entries name tcp/ip ip-hostname-or-address [ socket ] [ ; comment ] For TCP/IP, the format is: name network-type address [ network-specific-info ] [ ; comment ] network directory entry is: dialing directories (HELP DIAL for details). The general format of a Specifies the name(s) of zero or more network directory files, similar toSET NETWORK DIRECTORY [ file [ file [ ... ] ] ]SET HOST commands. Also see SET HOST, TELNET.If only one network type is listed above, that is the default network for SET NETWORK TYPE TCP/IPSelect the type of network to be used with SET HOST connections:Syntax: SET NETWORK { TYPE network-type, DIRECTORY [ file(s)... ] } addresses. default, means the lookup is done on hostnames, but not on numeric IP which host you are connected to and you are not using Kerberos. AUTO, the option OFF for speedier connections if you do not need to know exactly time (minutes) to fail, but the connection will still be made. Turn this other host does not have a DNS entry, the reverse lookup could take a long Kerberos connections to host pools and for incoming connections. If the to, which is useful for connections to host pools, and is required for so Kermit can determine the actual hostname of the host it is connected Tells Kermit whether to perform reverse DNS lookup on TCP/IP connectionsSET TCP REVERSE-DNS-LOOKUP { AUTO, ON, OFF }The following TCP and/or IP parameter(s) may also be changed:the underlying TCP/IP services.all options are necessarily available in all Kermit versions; it depends onthen at your own risk. These settings are displayed by SHOW NETWORK. Notyou understand the concepts (see, for example, the Comer TCP/IP books), andthat Kermit is using is giving you inadequate performance, and then only ifshould use these commands only if you feel that the TCP/IP protocol stackbasis by adjusting parameters you normally would not have access to. YouThese items let you tune TCP networking performance on a per-connection TCP receive and send buffer sizes. (default is -1, use system defaults.)SET TCP SENDBUF SET TCP RECVBUF (default is OFF.) to accumulate a bunch of them before transmitting (Nagle Algorithm). ON means send short TCP packets immediately rather than waitingSET TCP NODELAY { ON, OFF } (default is ON with a timeout of 0.) timeout measured in 10th of a millisecond. all outstanding data has been transferred and acknowledged. Setting this ON ensures that a connection doesn't close beforeSET TCP LINGER { ON [timeout], OFF } (default is ON.) Setting this ON might help to detect broken connections more quickly.SET TCP KEEPALIVE { ON, OFF } Specify no to remove the preference. when using authentication or listening for an incoming connection. instead of allowing the TCP/IP stack to choose. This may be necessary This allows a specific IP Address on a multihomed host to be usedSET TCP ADDRESS SHOW TELNET displays current Telnet settings. Use SHOW TELOPT to view current Telnet Option negotiation settings. negotiation. before connecting to the problem host, thus skipping the problematic is possible to use SET TELOPT to instruct Kermit to REFUSE the option they do not recognize and instead do not respond at all. In this case it Note that some of Kermit's Telnet partners fail to refuse options that given, the command applies to the client. when Kermit is the Telnet client or the Telnet server; if no switch is /CLIENT or /SERVER switch to indicate whether the given policies apply appropriate (option-specific) default is applied. You can also include a applies to Kermit's Telnet partner; if the second keyword is omitted, an for each direction; the first keyword applies to Kermit itself, the second Some options are negotiated in two directions and accept separate policies requested by the peer. requested. REFUSED instructs Kermit to refuse the option if it is in no offer but Kermit will attempt to negotiate the option if it is REQUESTED causes Kermit to offer an option to the peer. ACCEPTED results to offer the option to the peer and disconnect if the option is refused. Telnet option negotiations. Setting an option REQUIRED causes Kermit SET TELOPT lets you specify policy requirements for Kermit's handling of [ { ACCEPTED, REFUSED, REQUESTED, REQUIRED } ] { ACCEPTED, REFUSED, REQUESTED, REQUIRED } -SET TELOPT [ { /CLIENT, /SERVER } ]